Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3M9I4

Protein Details
Accession A0A5C3M9I4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
181-202IAVRKVQKARKRCHFTERKLEDHydrophilic
NLS Segment(s)
PositionSequence
46-50RKRGK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006880  INO80B_C  
Gene Ontology GO:0031011  C:Ino80 complex  
Pfam View protein in Pfam  
PF04795  PAPA-1  
Amino Acid Sequences MVAVATASACSPSVGGLKLKDDKRNRDNEDEKGHRNESKEVVVSPRKRGKVKKCAFLSLCLQLQHLPIGYIEPNSDSESDHDGTEASKKEDELDVEIKHNDEEQHKRHEDTNGDNAEGENHTRDEDSGISICSRCSWEASPRKEKMTACQAALASVLELGHASFDTMRSHLRKCVFNDTEIAVRKVQKARKRCHFTERKLEDEKVETVNRLLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.16
4 0.22
5 0.3
6 0.36
7 0.44
8 0.5
9 0.58
10 0.64
11 0.72
12 0.72
13 0.74
14 0.74
15 0.73
16 0.74
17 0.71
18 0.68
19 0.64
20 0.62
21 0.55
22 0.53
23 0.5
24 0.43
25 0.4
26 0.36
27 0.31
28 0.35
29 0.41
30 0.41
31 0.46
32 0.51
33 0.53
34 0.59
35 0.67
36 0.69
37 0.72
38 0.75
39 0.76
40 0.71
41 0.74
42 0.68
43 0.63
44 0.57
45 0.51
46 0.46
47 0.36
48 0.33
49 0.25
50 0.24
51 0.21
52 0.17
53 0.12
54 0.09
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.1
61 0.11
62 0.11
63 0.1
64 0.11
65 0.15
66 0.15
67 0.14
68 0.13
69 0.12
70 0.12
71 0.15
72 0.14
73 0.12
74 0.12
75 0.12
76 0.13
77 0.14
78 0.14
79 0.14
80 0.15
81 0.14
82 0.15
83 0.16
84 0.15
85 0.14
86 0.14
87 0.13
88 0.15
89 0.2
90 0.22
91 0.29
92 0.3
93 0.31
94 0.32
95 0.34
96 0.31
97 0.29
98 0.33
99 0.27
100 0.26
101 0.24
102 0.22
103 0.2
104 0.18
105 0.14
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.09
114 0.08
115 0.08
116 0.09
117 0.09
118 0.09
119 0.08
120 0.1
121 0.09
122 0.11
123 0.13
124 0.22
125 0.31
126 0.39
127 0.47
128 0.48
129 0.5
130 0.53
131 0.51
132 0.48
133 0.49
134 0.45
135 0.36
136 0.37
137 0.34
138 0.29
139 0.29
140 0.22
141 0.12
142 0.09
143 0.08
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.06
152 0.07
153 0.09
154 0.15
155 0.18
156 0.2
157 0.26
158 0.3
159 0.35
160 0.38
161 0.48
162 0.44
163 0.42
164 0.43
165 0.4
166 0.42
167 0.39
168 0.37
169 0.29
170 0.3
171 0.35
172 0.4
173 0.46
174 0.47
175 0.54
176 0.62
177 0.7
178 0.76
179 0.75
180 0.79
181 0.82
182 0.82
183 0.84
184 0.8
185 0.77
186 0.74
187 0.7
188 0.63
189 0.57
190 0.51
191 0.46
192 0.42
193 0.35
194 0.32