Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MGT7

Protein Details
Accession A0A5C3MGT7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-100QRGSEYQPSQRKRKRKHGFLARKKSIGGBasic
NLS Segment(s)
PositionSequence
83-113RKRKRKHGFLARKKSIGGRKVLSRRAAKGRR
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIARTLLQLIARPPVLPITSTAVRPSLSTTFSNPVPLMISRRLPNLPLISFISAVPTSSILGSLTQVRFAQRGSEYQPSQRKRKRKHGFLARKKSIGGRKVLSRRAAKGRRYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.2
4 0.18
5 0.16
6 0.17
7 0.19
8 0.2
9 0.21
10 0.22
11 0.2
12 0.2
13 0.2
14 0.21
15 0.17
16 0.18
17 0.19
18 0.2
19 0.22
20 0.22
21 0.24
22 0.2
23 0.18
24 0.17
25 0.17
26 0.17
27 0.17
28 0.2
29 0.19
30 0.22
31 0.23
32 0.22
33 0.24
34 0.23
35 0.2
36 0.19
37 0.19
38 0.17
39 0.17
40 0.16
41 0.15
42 0.11
43 0.11
44 0.09
45 0.08
46 0.07
47 0.06
48 0.07
49 0.04
50 0.05
51 0.06
52 0.09
53 0.09
54 0.1
55 0.1
56 0.11
57 0.12
58 0.12
59 0.14
60 0.12
61 0.14
62 0.17
63 0.24
64 0.25
65 0.32
66 0.41
67 0.44
68 0.54
69 0.59
70 0.65
71 0.68
72 0.78
73 0.8
74 0.82
75 0.87
76 0.87
77 0.91
78 0.92
79 0.93
80 0.89
81 0.8
82 0.72
83 0.69
84 0.66
85 0.6
86 0.56
87 0.5
88 0.53
89 0.6
90 0.65
91 0.65
92 0.63
93 0.65
94 0.69
95 0.72
96 0.69
97 0.7