Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3LNA9

Protein Details
Accession A0A5C3LNA9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77HGRALYRRNHPREFRVKRQABasic
NLS Segment(s)
Subcellular Location(s) extr 17, E.R. 5, mito 3
Family & Domain DBs
Amino Acid Sequences MRVSFAVIVVAAAAAVSNAAIIPRANMNSTIESRYYNDKVYVRHEEPRREPGVVHPGHGRALYRRNHPREFRVKRQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.03
8 0.04
9 0.05
10 0.07
11 0.08
12 0.09
13 0.1
14 0.12
15 0.15
16 0.16
17 0.17
18 0.16
19 0.16
20 0.17
21 0.21
22 0.21
23 0.19
24 0.21
25 0.21
26 0.22
27 0.26
28 0.32
29 0.28
30 0.35
31 0.39
32 0.43
33 0.45
34 0.5
35 0.47
36 0.41
37 0.39
38 0.37
39 0.41
40 0.34
41 0.32
42 0.28
43 0.27
44 0.28
45 0.28
46 0.24
47 0.2
48 0.27
49 0.31
50 0.39
51 0.48
52 0.55
53 0.63
54 0.68
55 0.72
56 0.76
57 0.79