Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MHZ7

Protein Details
Accession A0A5C3MHZ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-82RVCLSTCPKNRRPNRKGPKQVVMSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 4, E.R. 4, plas 2, golg 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038955  PriA/CPL1_fungi  
Amino Acid Sequences MARLILLVALFAFLGAVAARCPVGFALIPADDSVSKCICRSGTKIKKPDPSCAYTVSGRVCLSTCPKNRRPNRKGPKQVVMSDKGSREHCPEESEPCPINPTDVNSEMECIAPLEDIANCGGCVSLGKGQDCASVPGARVSECVRGVCKMRSCSRGYRLDAVAGTCISKPRIVDLLKEPSMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.05
8 0.06
9 0.06
10 0.08
11 0.07
12 0.08
13 0.1
14 0.11
15 0.11
16 0.11
17 0.12
18 0.11
19 0.12
20 0.15
21 0.13
22 0.13
23 0.13
24 0.16
25 0.17
26 0.19
27 0.25
28 0.33
29 0.42
30 0.51
31 0.59
32 0.64
33 0.72
34 0.71
35 0.74
36 0.69
37 0.63
38 0.56
39 0.5
40 0.46
41 0.37
42 0.38
43 0.3
44 0.26
45 0.22
46 0.2
47 0.17
48 0.16
49 0.2
50 0.25
51 0.31
52 0.38
53 0.46
54 0.56
55 0.65
56 0.74
57 0.77
58 0.79
59 0.83
60 0.85
61 0.87
62 0.83
63 0.83
64 0.76
65 0.74
66 0.68
67 0.61
68 0.53
69 0.46
70 0.41
71 0.36
72 0.32
73 0.28
74 0.26
75 0.24
76 0.22
77 0.23
78 0.22
79 0.24
80 0.23
81 0.25
82 0.23
83 0.2
84 0.21
85 0.16
86 0.17
87 0.13
88 0.14
89 0.14
90 0.16
91 0.17
92 0.16
93 0.17
94 0.16
95 0.15
96 0.12
97 0.09
98 0.07
99 0.05
100 0.05
101 0.05
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.05
111 0.06
112 0.09
113 0.12
114 0.12
115 0.13
116 0.14
117 0.17
118 0.17
119 0.18
120 0.17
121 0.16
122 0.16
123 0.18
124 0.18
125 0.15
126 0.16
127 0.16
128 0.18
129 0.18
130 0.19
131 0.18
132 0.21
133 0.24
134 0.29
135 0.33
136 0.36
137 0.41
138 0.45
139 0.49
140 0.54
141 0.59
142 0.61
143 0.59
144 0.58
145 0.53
146 0.5
147 0.46
148 0.39
149 0.33
150 0.25
151 0.22
152 0.17
153 0.19
154 0.17
155 0.17
156 0.17
157 0.19
158 0.26
159 0.26
160 0.3
161 0.35
162 0.42