Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3LXT5

Protein Details
Accession A0A5C3LXT5    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-29SRYHWSQDDKIPRRYKREACGGEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, cyto 5.5, cyto_nucl 5.5, mito 5, nucl 4.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023213  CAT-like_dom_sf  
IPR009992  Tri3/Sat12/Sat16/Mac1  
Gene Ontology GO:0016407  F:acetyltransferase activity  
GO:0043386  P:mycotoxin biosynthetic process  
Pfam View protein in Pfam  
PF07428  Tri3  
Amino Acid Sequences MDYFDYSRYHWSQDDKIPRRYKREACGGELMEDIWNVMNHGEQNLFIGVYARLSDPNASFDLFEKIRCAWKSLRWDVPTIACSTMHVQNGQRPPKTFITYDVAYSIEEVDEWARQTVNLKDGFSNLDDLRYDVGQEPVPAEDLGLQTFLYVALFSATTFGVLLRTSHVPFDGAGTKILMSKLFGHLTHYITDPDYALTQNFTCNWGMEWKNLLPAKMEALGEIEAVVVTNDAENAPVEEELTGESRDGLEFSDSLSKVLTSITTSLPRAHVFKSFIHPPFNADLQKPSTRRLAHIFTAEQSVKIKKAGYDVEGTSGRLTVNHLIHGALCLLPVIDNPPTNPDGVLFYYGLVDGRPCLAKKYRGPLDFPGYCIGMSPIIIPISFIHSLPLHDHKASVLSLAGAVQLEYKKQKELPSLVSMEPQLIESMLSYAPPPPPSAFPSYSGDGVGSRYLLPKYPMTGPTVIEITDFFVGLNKCDPGPFFRTTEWNGRIMLSVDFNEKAVEATVVQGWMDKWRELILSLTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.65
4 0.72
5 0.75
6 0.78
7 0.81
8 0.8
9 0.77
10 0.8
11 0.75
12 0.71
13 0.72
14 0.64
15 0.56
16 0.48
17 0.4
18 0.29
19 0.24
20 0.19
21 0.12
22 0.11
23 0.09
24 0.09
25 0.1
26 0.1
27 0.12
28 0.12
29 0.11
30 0.12
31 0.13
32 0.12
33 0.1
34 0.11
35 0.09
36 0.09
37 0.11
38 0.1
39 0.1
40 0.12
41 0.15
42 0.15
43 0.18
44 0.18
45 0.18
46 0.17
47 0.18
48 0.23
49 0.2
50 0.2
51 0.19
52 0.2
53 0.27
54 0.28
55 0.31
56 0.29
57 0.36
58 0.45
59 0.5
60 0.57
61 0.52
62 0.54
63 0.52
64 0.52
65 0.47
66 0.39
67 0.33
68 0.24
69 0.23
70 0.24
71 0.26
72 0.24
73 0.25
74 0.25
75 0.31
76 0.41
77 0.47
78 0.47
79 0.45
80 0.49
81 0.52
82 0.54
83 0.47
84 0.42
85 0.41
86 0.38
87 0.36
88 0.31
89 0.25
90 0.2
91 0.2
92 0.16
93 0.08
94 0.07
95 0.07
96 0.07
97 0.08
98 0.09
99 0.09
100 0.09
101 0.09
102 0.13
103 0.15
104 0.2
105 0.21
106 0.21
107 0.21
108 0.22
109 0.24
110 0.21
111 0.23
112 0.17
113 0.17
114 0.16
115 0.16
116 0.16
117 0.14
118 0.15
119 0.12
120 0.14
121 0.12
122 0.13
123 0.12
124 0.11
125 0.13
126 0.11
127 0.1
128 0.1
129 0.09
130 0.09
131 0.09
132 0.08
133 0.07
134 0.07
135 0.07
136 0.05
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.08
151 0.11
152 0.11
153 0.12
154 0.12
155 0.12
156 0.11
157 0.14
158 0.15
159 0.13
160 0.12
161 0.12
162 0.12
163 0.13
164 0.14
165 0.11
166 0.09
167 0.1
168 0.13
169 0.15
170 0.14
171 0.16
172 0.19
173 0.2
174 0.2
175 0.19
176 0.17
177 0.16
178 0.16
179 0.13
180 0.1
181 0.1
182 0.09
183 0.08
184 0.09
185 0.08
186 0.09
187 0.09
188 0.11
189 0.1
190 0.1
191 0.11
192 0.15
193 0.16
194 0.17
195 0.19
196 0.17
197 0.23
198 0.24
199 0.23
200 0.19
201 0.18
202 0.18
203 0.17
204 0.17
205 0.11
206 0.11
207 0.11
208 0.09
209 0.08
210 0.07
211 0.04
212 0.04
213 0.04
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.04
222 0.04
223 0.04
224 0.05
225 0.04
226 0.04
227 0.05
228 0.06
229 0.06
230 0.05
231 0.05
232 0.05
233 0.06
234 0.06
235 0.05
236 0.05
237 0.04
238 0.05
239 0.1
240 0.1
241 0.1
242 0.1
243 0.1
244 0.09
245 0.09
246 0.09
247 0.05
248 0.06
249 0.08
250 0.1
251 0.11
252 0.11
253 0.13
254 0.14
255 0.15
256 0.15
257 0.17
258 0.17
259 0.18
260 0.22
261 0.27
262 0.28
263 0.29
264 0.28
265 0.27
266 0.27
267 0.29
268 0.26
269 0.2
270 0.21
271 0.22
272 0.28
273 0.27
274 0.27
275 0.3
276 0.29
277 0.31
278 0.33
279 0.33
280 0.29
281 0.31
282 0.29
283 0.23
284 0.27
285 0.25
286 0.2
287 0.19
288 0.18
289 0.16
290 0.17
291 0.17
292 0.12
293 0.16
294 0.17
295 0.17
296 0.19
297 0.18
298 0.2
299 0.2
300 0.2
301 0.16
302 0.15
303 0.12
304 0.1
305 0.11
306 0.13
307 0.13
308 0.13
309 0.14
310 0.13
311 0.13
312 0.13
313 0.12
314 0.06
315 0.06
316 0.05
317 0.04
318 0.04
319 0.04
320 0.06
321 0.08
322 0.08
323 0.09
324 0.12
325 0.13
326 0.13
327 0.13
328 0.11
329 0.12
330 0.12
331 0.14
332 0.1
333 0.1
334 0.1
335 0.1
336 0.09
337 0.07
338 0.06
339 0.05
340 0.07
341 0.09
342 0.09
343 0.13
344 0.18
345 0.26
346 0.31
347 0.4
348 0.46
349 0.47
350 0.5
351 0.51
352 0.55
353 0.48
354 0.45
355 0.37
356 0.3
357 0.27
358 0.23
359 0.18
360 0.1
361 0.1
362 0.08
363 0.08
364 0.08
365 0.08
366 0.08
367 0.08
368 0.12
369 0.13
370 0.12
371 0.13
372 0.13
373 0.14
374 0.18
375 0.23
376 0.21
377 0.21
378 0.21
379 0.19
380 0.21
381 0.2
382 0.17
383 0.11
384 0.08
385 0.08
386 0.08
387 0.08
388 0.06
389 0.06
390 0.08
391 0.08
392 0.12
393 0.17
394 0.18
395 0.21
396 0.25
397 0.29
398 0.34
399 0.38
400 0.4
401 0.41
402 0.43
403 0.4
404 0.39
405 0.35
406 0.28
407 0.23
408 0.19
409 0.13
410 0.09
411 0.09
412 0.06
413 0.08
414 0.07
415 0.07
416 0.07
417 0.1
418 0.13
419 0.14
420 0.16
421 0.17
422 0.2
423 0.24
424 0.31
425 0.3
426 0.3
427 0.34
428 0.34
429 0.33
430 0.3
431 0.26
432 0.2
433 0.19
434 0.16
435 0.12
436 0.11
437 0.13
438 0.14
439 0.16
440 0.19
441 0.19
442 0.22
443 0.27
444 0.28
445 0.3
446 0.31
447 0.29
448 0.29
449 0.27
450 0.24
451 0.18
452 0.16
453 0.14
454 0.13
455 0.12
456 0.09
457 0.13
458 0.14
459 0.15
460 0.17
461 0.16
462 0.16
463 0.17
464 0.19
465 0.2
466 0.25
467 0.27
468 0.27
469 0.29
470 0.35
471 0.39
472 0.48
473 0.45
474 0.42
475 0.39
476 0.37
477 0.35
478 0.3
479 0.27
480 0.2
481 0.19
482 0.2
483 0.2
484 0.19
485 0.18
486 0.17
487 0.15
488 0.13
489 0.12
490 0.09
491 0.1
492 0.11
493 0.11
494 0.11
495 0.12
496 0.12
497 0.18
498 0.21
499 0.2
500 0.19
501 0.21
502 0.22
503 0.21