Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MCJ6

Protein Details
Accession A0A5C3MCJ6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-60AFYDRWNKGKQWKDIRHKYVEEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 5, golg 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MPLSNTLYNTFFKRNSVFVATIFAGAFTFGVGFDLGVTAFYDRWNKGKQWKDIRHKYVEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.3
4 0.27
5 0.22
6 0.25
7 0.21
8 0.2
9 0.18
10 0.14
11 0.1
12 0.09
13 0.08
14 0.04
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.07
28 0.11
29 0.12
30 0.17
31 0.2
32 0.24
33 0.33
34 0.42
35 0.5
36 0.57
37 0.67
38 0.73
39 0.8
40 0.84
41 0.83