Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MCW5

Protein Details
Accession A0A5C3MCW5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
42-62ELVRWKWVKYQQKKQEEMRALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 6.5, pero 6, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024242  NCE101  
Gene Ontology GO:0016020  C:membrane  
GO:0009306  P:protein secretion  
Pfam View protein in Pfam  
PF11654  NCE101  
Amino Acid Sequences MPPVLLSRGLDPILGVFTGFLAFYLYETHPRNNVPADQRLAELVRWKWVKYQQKKQEEMRALDAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.05
11 0.08
12 0.08
13 0.14
14 0.16
15 0.18
16 0.19
17 0.19
18 0.21
19 0.19
20 0.23
21 0.2
22 0.23
23 0.24
24 0.22
25 0.22
26 0.22
27 0.21
28 0.18
29 0.2
30 0.16
31 0.22
32 0.23
33 0.23
34 0.28
35 0.36
36 0.46
37 0.51
38 0.61
39 0.64
40 0.72
41 0.79
42 0.81
43 0.82
44 0.79
45 0.74
46 0.68