Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3M6T5

Protein Details
Accession A0A5C3M6T5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-71ITQGLRCRSRCRRSWMSRTSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MAHSSGLALDDYARYGRQMILDRFGLPGQPTIPRFLRPCIHLRPSTRATQITQGLRCRSRCRRSWMSRTSVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.14
5 0.21
6 0.21
7 0.24
8 0.25
9 0.24
10 0.25
11 0.24
12 0.2
13 0.14
14 0.14
15 0.11
16 0.14
17 0.14
18 0.17
19 0.19
20 0.21
21 0.22
22 0.24
23 0.26
24 0.25
25 0.29
26 0.31
27 0.36
28 0.37
29 0.39
30 0.43
31 0.44
32 0.45
33 0.43
34 0.39
35 0.36
36 0.37
37 0.4
38 0.39
39 0.4
40 0.41
41 0.44
42 0.48
43 0.51
44 0.54
45 0.58
46 0.61
47 0.64
48 0.68
49 0.72
50 0.77
51 0.83
52 0.82