Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3LN69

Protein Details
Accession A0A5C3LN69    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-54GTSTPDPPIRRQRSRRVTRRYLGHREHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MALLLRIIKWCALALTAGSTLLTTGVGIGTSTPDPPIRRQRSRRVTRRYLGHRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.08
5 0.07
6 0.07
7 0.06
8 0.06
9 0.05
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.04
17 0.05
18 0.05
19 0.06
20 0.1
21 0.12
22 0.19
23 0.3
24 0.38
25 0.48
26 0.56
27 0.66
28 0.74
29 0.83
30 0.87
31 0.86
32 0.87
33 0.85
34 0.87