Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LXQ7

Protein Details
Accession A0A5C3LXQ7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-81SRVRDPYSQVMRRRRRREFCDSLTKRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences ILILMVITSLLYEPRSRYVSRAMEVASHLNTKVGLRAPRPIRRSHQRAGPCPPTGSRVRDPYSQVMRRRRRREFCDSLTKRKLNSRSGHQQMKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.21
4 0.23
5 0.3
6 0.33
7 0.33
8 0.33
9 0.28
10 0.26
11 0.27
12 0.27
13 0.2
14 0.17
15 0.16
16 0.14
17 0.14
18 0.12
19 0.13
20 0.15
21 0.17
22 0.17
23 0.25
24 0.32
25 0.39
26 0.42
27 0.45
28 0.48
29 0.55
30 0.6
31 0.56
32 0.56
33 0.55
34 0.57
35 0.6
36 0.57
37 0.48
38 0.43
39 0.4
40 0.37
41 0.34
42 0.35
43 0.33
44 0.34
45 0.36
46 0.38
47 0.41
48 0.44
49 0.49
50 0.5
51 0.54
52 0.58
53 0.65
54 0.72
55 0.78
56 0.81
57 0.82
58 0.83
59 0.85
60 0.83
61 0.8
62 0.81
63 0.78
64 0.77
65 0.77
66 0.73
67 0.67
68 0.67
69 0.67
70 0.64
71 0.65
72 0.64
73 0.66
74 0.72