Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LXI0

Protein Details
Accession A0A5C3LXI0    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-36KEATKSKRKVAEKAEKAPRKGKKDPKAPKRALSABasic
NLS Segment(s)
PositionSequence
6-32TKSKRKVAEKAEKAPRKGKKDPKAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEATKSKRKVAEKAEKAPRKGKKDPKAPKRALSAYMFFSQDWRERIKAENPDAGFGEVGKLLGAKWKELDDEEKKPYVDQAARDKTRAEEEKAVYDGNKKSASADEDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.81
4 0.79
5 0.78
6 0.79
7 0.77
8 0.74
9 0.75
10 0.76
11 0.75
12 0.79
13 0.84
14 0.86
15 0.88
16 0.85
17 0.81
18 0.78
19 0.72
20 0.66
21 0.59
22 0.5
23 0.43
24 0.4
25 0.34
26 0.26
27 0.24
28 0.22
29 0.22
30 0.21
31 0.21
32 0.19
33 0.2
34 0.23
35 0.28
36 0.32
37 0.31
38 0.33
39 0.3
40 0.3
41 0.3
42 0.26
43 0.2
44 0.13
45 0.11
46 0.06
47 0.06
48 0.04
49 0.04
50 0.03
51 0.08
52 0.08
53 0.08
54 0.09
55 0.1
56 0.11
57 0.12
58 0.2
59 0.21
60 0.26
61 0.29
62 0.3
63 0.3
64 0.29
65 0.29
66 0.28
67 0.25
68 0.26
69 0.32
70 0.4
71 0.42
72 0.43
73 0.43
74 0.39
75 0.44
76 0.43
77 0.38
78 0.36
79 0.36
80 0.39
81 0.39
82 0.38
83 0.31
84 0.33
85 0.3
86 0.29
87 0.28
88 0.25
89 0.25
90 0.29
91 0.31
92 0.29
93 0.3