Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FX81

Protein Details
Accession C5FX81    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
173-192IRSGRRRRSRAQHLPNDSRKBasic
NLS Segment(s)
PositionSequence
159-162RRAS
167-218RDTPKAIRSGRRRRSRAQHLPNDSRKAGNKTVEQKDIKIPRSPGNRSPRPSR
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MAHINSLVYLDQDRWLPVSHAQPAPGSGYSFEIACTPDLHEAMYFVREQPAEQIVSYQGVFPNNIGYCPVCKALYDRSSNGRFTYQDLPPAVIYTRDEFTAVCCERPLQFISNGRASPEIVAYPSMVNGPGTTNSITLVQSIVNAPSYVILNKNQGKHRRASRESCRDTPKAIRSGRRRRSRAQHLPNDSRKAGNKTVEQKDIKIPRSPGNRSPRPSRAHSPIPFSRASTLAESPAPVQSPTSKVINLPPQAPLDSPKLHAQEPHVCMHDRREKQGPMRQGGLECGRAESIVSSSTDSTQLGIIPPHKLAIPRNPLNATENKPRFVGRSSARKTGKRGWLKFWRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.21
5 0.26
6 0.31
7 0.31
8 0.32
9 0.31
10 0.31
11 0.32
12 0.29
13 0.24
14 0.17
15 0.18
16 0.17
17 0.16
18 0.15
19 0.13
20 0.13
21 0.13
22 0.13
23 0.12
24 0.15
25 0.15
26 0.15
27 0.14
28 0.14
29 0.14
30 0.15
31 0.14
32 0.11
33 0.15
34 0.15
35 0.15
36 0.17
37 0.2
38 0.19
39 0.18
40 0.19
41 0.15
42 0.17
43 0.17
44 0.15
45 0.14
46 0.14
47 0.15
48 0.13
49 0.18
50 0.17
51 0.17
52 0.17
53 0.15
54 0.16
55 0.18
56 0.2
57 0.14
58 0.14
59 0.18
60 0.25
61 0.31
62 0.34
63 0.34
64 0.4
65 0.44
66 0.45
67 0.43
68 0.38
69 0.31
70 0.31
71 0.35
72 0.28
73 0.3
74 0.29
75 0.29
76 0.26
77 0.26
78 0.22
79 0.17
80 0.17
81 0.14
82 0.14
83 0.13
84 0.13
85 0.12
86 0.13
87 0.21
88 0.2
89 0.17
90 0.17
91 0.18
92 0.18
93 0.21
94 0.22
95 0.16
96 0.2
97 0.25
98 0.29
99 0.32
100 0.31
101 0.3
102 0.28
103 0.25
104 0.22
105 0.17
106 0.13
107 0.09
108 0.09
109 0.09
110 0.08
111 0.08
112 0.07
113 0.07
114 0.06
115 0.06
116 0.07
117 0.07
118 0.09
119 0.09
120 0.09
121 0.09
122 0.1
123 0.1
124 0.09
125 0.09
126 0.07
127 0.07
128 0.08
129 0.07
130 0.06
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.08
137 0.09
138 0.16
139 0.19
140 0.25
141 0.31
142 0.39
143 0.41
144 0.46
145 0.53
146 0.56
147 0.58
148 0.61
149 0.65
150 0.67
151 0.7
152 0.7
153 0.68
154 0.6
155 0.57
156 0.54
157 0.49
158 0.47
159 0.45
160 0.47
161 0.51
162 0.61
163 0.67
164 0.71
165 0.71
166 0.71
167 0.77
168 0.79
169 0.8
170 0.79
171 0.78
172 0.76
173 0.81
174 0.79
175 0.74
176 0.64
177 0.56
178 0.5
179 0.47
180 0.43
181 0.38
182 0.37
183 0.41
184 0.45
185 0.5
186 0.47
187 0.43
188 0.47
189 0.5
190 0.46
191 0.42
192 0.4
193 0.4
194 0.47
195 0.5
196 0.51
197 0.54
198 0.58
199 0.59
200 0.64
201 0.65
202 0.62
203 0.64
204 0.62
205 0.58
206 0.6
207 0.58
208 0.58
209 0.54
210 0.52
211 0.47
212 0.41
213 0.36
214 0.28
215 0.27
216 0.22
217 0.19
218 0.17
219 0.17
220 0.16
221 0.15
222 0.15
223 0.14
224 0.11
225 0.11
226 0.12
227 0.15
228 0.17
229 0.18
230 0.17
231 0.17
232 0.23
233 0.3
234 0.3
235 0.28
236 0.28
237 0.28
238 0.28
239 0.28
240 0.25
241 0.23
242 0.22
243 0.24
244 0.27
245 0.28
246 0.28
247 0.29
248 0.32
249 0.35
250 0.37
251 0.38
252 0.35
253 0.34
254 0.34
255 0.41
256 0.45
257 0.39
258 0.42
259 0.46
260 0.5
261 0.56
262 0.62
263 0.62
264 0.56
265 0.56
266 0.53
267 0.46
268 0.45
269 0.4
270 0.36
271 0.28
272 0.25
273 0.22
274 0.19
275 0.19
276 0.14
277 0.12
278 0.1
279 0.1
280 0.11
281 0.12
282 0.13
283 0.14
284 0.13
285 0.13
286 0.12
287 0.12
288 0.12
289 0.15
290 0.16
291 0.17
292 0.17
293 0.17
294 0.19
295 0.21
296 0.26
297 0.32
298 0.4
299 0.43
300 0.48
301 0.49
302 0.5
303 0.52
304 0.54
305 0.51
306 0.52
307 0.51
308 0.47
309 0.47
310 0.46
311 0.44
312 0.4
313 0.42
314 0.4
315 0.46
316 0.5
317 0.58
318 0.65
319 0.67
320 0.71
321 0.72
322 0.74
323 0.74
324 0.73
325 0.74