Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MEI1

Protein Details
Accession A0A5C3MEI1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
419-443STVGRVEKGKERDREKKAKVTTQCTHydrophilic
NLS Segment(s)
PositionSequence
430-434RDREK
Subcellular Location(s) mito 19, nucl 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Amino Acid Sequences MNLARHSISSTNPIHVLDARFDPDCKIFTAATPAGFAVYRASPLKLIRKRELTGGTLAAVVPLHTSNLLFLVGGGRSPLYPPNKVVLWDDALGKEVAELEFREKVRGLACRRGWLAVALRRRVVVFEVGEQVTRYGEWDTCDNPQGLLAMATAPYSTLLAIAGRQMGHVQMVHLPRCPLPMFSGPPPSSPPLKPPPYPTKPHVSIIAAHTTALTTLSLPPSGKLLATTSLRGTLIRIWDSWTGKLIKELRRGTDKAEIYGVAFRPDEQEVCVWSDKGTVHVFHIEVSNRQSSLSGLAPFIPLPKYFDSEWSYAQYRIPVQSSHISLSSTTRSSIVDAPDEERCVVGWVDVSADNSTPSHTTPPKYQLVALTYMGGWYRLSLPDPEQSAKMASSPSLVSGTSASPPKSMPAVPRTSSGSSTVGRVEKGKERDREKKAKVTTQCTLQEFRRFGRWDGWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.31
4 0.26
5 0.27
6 0.27
7 0.27
8 0.27
9 0.28
10 0.26
11 0.25
12 0.23
13 0.23
14 0.2
15 0.2
16 0.27
17 0.26
18 0.24
19 0.23
20 0.21
21 0.19
22 0.19
23 0.18
24 0.13
25 0.12
26 0.15
27 0.16
28 0.17
29 0.19
30 0.25
31 0.35
32 0.39
33 0.46
34 0.51
35 0.56
36 0.57
37 0.61
38 0.59
39 0.52
40 0.48
41 0.41
42 0.33
43 0.27
44 0.25
45 0.18
46 0.14
47 0.11
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.07
54 0.08
55 0.08
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.09
65 0.16
66 0.19
67 0.22
68 0.24
69 0.27
70 0.28
71 0.3
72 0.31
73 0.27
74 0.26
75 0.25
76 0.24
77 0.2
78 0.21
79 0.19
80 0.16
81 0.12
82 0.1
83 0.09
84 0.09
85 0.09
86 0.11
87 0.16
88 0.17
89 0.19
90 0.18
91 0.19
92 0.22
93 0.29
94 0.31
95 0.35
96 0.37
97 0.41
98 0.41
99 0.4
100 0.37
101 0.33
102 0.35
103 0.32
104 0.37
105 0.34
106 0.34
107 0.34
108 0.34
109 0.3
110 0.25
111 0.23
112 0.16
113 0.16
114 0.19
115 0.19
116 0.19
117 0.18
118 0.17
119 0.13
120 0.12
121 0.11
122 0.08
123 0.09
124 0.1
125 0.12
126 0.14
127 0.16
128 0.18
129 0.17
130 0.16
131 0.15
132 0.13
133 0.11
134 0.1
135 0.08
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.11
158 0.15
159 0.16
160 0.17
161 0.18
162 0.17
163 0.2
164 0.2
165 0.16
166 0.16
167 0.2
168 0.22
169 0.23
170 0.31
171 0.28
172 0.29
173 0.31
174 0.3
175 0.3
176 0.27
177 0.31
178 0.32
179 0.36
180 0.37
181 0.42
182 0.5
183 0.52
184 0.57
185 0.54
186 0.53
187 0.52
188 0.51
189 0.46
190 0.37
191 0.33
192 0.3
193 0.3
194 0.21
195 0.18
196 0.16
197 0.13
198 0.12
199 0.1
200 0.07
201 0.04
202 0.05
203 0.06
204 0.07
205 0.08
206 0.08
207 0.08
208 0.09
209 0.08
210 0.07
211 0.08
212 0.1
213 0.11
214 0.11
215 0.11
216 0.11
217 0.12
218 0.11
219 0.11
220 0.1
221 0.11
222 0.11
223 0.11
224 0.13
225 0.17
226 0.18
227 0.17
228 0.19
229 0.18
230 0.17
231 0.22
232 0.26
233 0.28
234 0.35
235 0.37
236 0.37
237 0.42
238 0.42
239 0.4
240 0.42
241 0.36
242 0.29
243 0.27
244 0.24
245 0.19
246 0.21
247 0.19
248 0.12
249 0.12
250 0.11
251 0.12
252 0.13
253 0.12
254 0.1
255 0.1
256 0.1
257 0.13
258 0.13
259 0.11
260 0.1
261 0.13
262 0.12
263 0.14
264 0.15
265 0.13
266 0.13
267 0.15
268 0.15
269 0.13
270 0.16
271 0.13
272 0.14
273 0.17
274 0.17
275 0.15
276 0.15
277 0.15
278 0.12
279 0.14
280 0.14
281 0.12
282 0.11
283 0.12
284 0.12
285 0.12
286 0.13
287 0.12
288 0.1
289 0.13
290 0.14
291 0.17
292 0.16
293 0.21
294 0.24
295 0.25
296 0.26
297 0.26
298 0.27
299 0.25
300 0.25
301 0.23
302 0.21
303 0.21
304 0.21
305 0.17
306 0.19
307 0.22
308 0.23
309 0.22
310 0.21
311 0.19
312 0.18
313 0.2
314 0.2
315 0.17
316 0.16
317 0.15
318 0.15
319 0.17
320 0.19
321 0.18
322 0.18
323 0.18
324 0.2
325 0.21
326 0.21
327 0.19
328 0.16
329 0.14
330 0.13
331 0.12
332 0.1
333 0.08
334 0.07
335 0.09
336 0.1
337 0.11
338 0.1
339 0.1
340 0.11
341 0.1
342 0.12
343 0.11
344 0.12
345 0.18
346 0.21
347 0.24
348 0.3
349 0.36
350 0.4
351 0.4
352 0.41
353 0.37
354 0.36
355 0.36
356 0.3
357 0.24
358 0.19
359 0.19
360 0.17
361 0.14
362 0.11
363 0.08
364 0.1
365 0.11
366 0.12
367 0.14
368 0.17
369 0.21
370 0.25
371 0.26
372 0.25
373 0.24
374 0.24
375 0.22
376 0.21
377 0.17
378 0.13
379 0.13
380 0.13
381 0.13
382 0.13
383 0.13
384 0.12
385 0.12
386 0.14
387 0.16
388 0.2
389 0.2
390 0.2
391 0.2
392 0.22
393 0.24
394 0.26
395 0.28
396 0.32
397 0.38
398 0.39
399 0.42
400 0.45
401 0.44
402 0.42
403 0.39
404 0.35
405 0.28
406 0.29
407 0.31
408 0.28
409 0.27
410 0.28
411 0.3
412 0.35
413 0.43
414 0.49
415 0.53
416 0.6
417 0.68
418 0.75
419 0.81
420 0.8
421 0.81
422 0.81
423 0.81
424 0.81
425 0.79
426 0.75
427 0.73
428 0.73
429 0.67
430 0.65
431 0.62
432 0.62
433 0.58
434 0.55
435 0.56
436 0.52
437 0.5