Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LRX8

Protein Details
Accession A0A5C3LRX8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
162-189DDKDEPKDKKLGKKKPKKASKTLLSFGDBasic
NLS Segment(s)
PositionSequence
150-182KSSKRKAVGQPEDDKDEPKDKKLGKKKPKKASK
Subcellular Location(s) nucl 20.5, mito_nucl 13.166, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPKEPTRAQLSSKLSYQQKTPAFLLRLQNKIAGVPDEEEEDEEFEHDGSGRPPIPKRPAIPERPDEDPGSADEDDGDEKPQVVVLREGKHLSEREVQNIKRQDKGLAPLPDPEDIVAKLKLPEPSKDTPSGSKTQPQGLSFSSGKASSKSSKRKAVGQPEDDKDEPKDKKLGKKKPKKASKTLLSFGDDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.48
4 0.47
5 0.47
6 0.45
7 0.45
8 0.45
9 0.44
10 0.41
11 0.44
12 0.5
13 0.48
14 0.48
15 0.44
16 0.44
17 0.37
18 0.35
19 0.32
20 0.24
21 0.18
22 0.16
23 0.16
24 0.15
25 0.15
26 0.15
27 0.14
28 0.13
29 0.11
30 0.1
31 0.1
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.1
38 0.12
39 0.16
40 0.19
41 0.26
42 0.32
43 0.36
44 0.39
45 0.45
46 0.52
47 0.56
48 0.6
49 0.58
50 0.55
51 0.54
52 0.54
53 0.45
54 0.37
55 0.3
56 0.24
57 0.22
58 0.18
59 0.14
60 0.11
61 0.11
62 0.11
63 0.11
64 0.11
65 0.07
66 0.07
67 0.07
68 0.08
69 0.08
70 0.08
71 0.11
72 0.14
73 0.17
74 0.18
75 0.19
76 0.18
77 0.2
78 0.2
79 0.2
80 0.23
81 0.21
82 0.26
83 0.31
84 0.32
85 0.35
86 0.43
87 0.41
88 0.37
89 0.37
90 0.33
91 0.29
92 0.33
93 0.33
94 0.29
95 0.28
96 0.27
97 0.28
98 0.26
99 0.24
100 0.21
101 0.14
102 0.12
103 0.13
104 0.11
105 0.1
106 0.11
107 0.13
108 0.18
109 0.19
110 0.21
111 0.25
112 0.29
113 0.32
114 0.34
115 0.34
116 0.33
117 0.36
118 0.37
119 0.34
120 0.35
121 0.34
122 0.37
123 0.39
124 0.35
125 0.34
126 0.3
127 0.34
128 0.28
129 0.27
130 0.22
131 0.19
132 0.19
133 0.18
134 0.21
135 0.24
136 0.33
137 0.42
138 0.48
139 0.56
140 0.58
141 0.66
142 0.7
143 0.74
144 0.74
145 0.71
146 0.72
147 0.68
148 0.72
149 0.63
150 0.57
151 0.5
152 0.5
153 0.44
154 0.4
155 0.44
156 0.43
157 0.53
158 0.61
159 0.68
160 0.7
161 0.79
162 0.85
163 0.88
164 0.93
165 0.92
166 0.92
167 0.91
168 0.9
169 0.88
170 0.84
171 0.78