Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3LKG1

Protein Details
Accession A0A5C3LKG1    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSCHNRKRKSGKKEGRLPASLHydrophilic
NLS Segment(s)
PositionSequence
6-15RKRKSGKKEG
Subcellular Location(s) mito 14, cyto 5, extr 4, nucl 2, plas 2
Family & Domain DBs
Amino Acid Sequences MSCHNRKRKSGKKEGRLPASLLLCLSIQAEVWVGEWRHRMKYIIRTCMVLPFHDILTISTFNRFCTSPISRTFHCPTPLLLLAPPGLDALTTEAGGHGHGIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.79
4 0.71
5 0.65
6 0.56
7 0.46
8 0.35
9 0.27
10 0.18
11 0.16
12 0.14
13 0.08
14 0.06
15 0.06
16 0.06
17 0.05
18 0.06
19 0.09
20 0.09
21 0.12
22 0.17
23 0.19
24 0.2
25 0.21
26 0.23
27 0.24
28 0.34
29 0.38
30 0.4
31 0.38
32 0.37
33 0.37
34 0.4
35 0.36
36 0.26
37 0.21
38 0.15
39 0.14
40 0.13
41 0.13
42 0.09
43 0.11
44 0.12
45 0.1
46 0.12
47 0.13
48 0.13
49 0.15
50 0.15
51 0.13
52 0.18
53 0.22
54 0.23
55 0.3
56 0.35
57 0.34
58 0.41
59 0.44
60 0.43
61 0.42
62 0.38
63 0.32
64 0.33
65 0.33
66 0.28
67 0.24
68 0.2
69 0.17
70 0.16
71 0.15
72 0.09
73 0.08
74 0.06
75 0.07
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.1