Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q758G8

Protein Details
Accession Q758G8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
156-180AADRHRLHGKRRQGERKRLRGRVEYBasic
NLS Segment(s)
PositionSequence
156-177AADRHRLHGKRRQGERKRLRGR
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0004045  F:aminoacyl-tRNA hydrolase activity  
GO:0016150  F:translation release factor activity, codon nonspecific  
GO:0070126  P:mitochondrial translational termination  
KEGG ago:AGOS_AEL206C  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MIIWRAAHSCFRTSTMPWAMRATRRYSDGAAEMRGWLEQLHWSQIPKQLYRAQYARSSGPGGQNVNKVSTKCTLTVEGFSKCAWFPALVREQAVRRLRYYARAQDAVVVQCDQWRSRERNREECLRRLVRELKAVVHVAAAPDPVAEARHARLHAAADRHRLHGKRRQGERKRLRGRVEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.39
4 0.38
5 0.42
6 0.43
7 0.46
8 0.49
9 0.47
10 0.41
11 0.42
12 0.43
13 0.38
14 0.37
15 0.35
16 0.33
17 0.29
18 0.25
19 0.22
20 0.2
21 0.18
22 0.15
23 0.1
24 0.08
25 0.11
26 0.12
27 0.15
28 0.16
29 0.18
30 0.21
31 0.27
32 0.31
33 0.27
34 0.31
35 0.33
36 0.34
37 0.39
38 0.39
39 0.36
40 0.36
41 0.37
42 0.34
43 0.3
44 0.3
45 0.26
46 0.27
47 0.27
48 0.25
49 0.26
50 0.28
51 0.27
52 0.28
53 0.28
54 0.24
55 0.23
56 0.24
57 0.23
58 0.2
59 0.21
60 0.2
61 0.19
62 0.22
63 0.22
64 0.2
65 0.19
66 0.17
67 0.17
68 0.14
69 0.13
70 0.1
71 0.08
72 0.07
73 0.12
74 0.16
75 0.15
76 0.16
77 0.17
78 0.18
79 0.25
80 0.3
81 0.25
82 0.23
83 0.26
84 0.26
85 0.31
86 0.36
87 0.34
88 0.33
89 0.33
90 0.32
91 0.31
92 0.32
93 0.27
94 0.23
95 0.17
96 0.12
97 0.13
98 0.15
99 0.12
100 0.14
101 0.2
102 0.25
103 0.33
104 0.43
105 0.48
106 0.56
107 0.6
108 0.67
109 0.66
110 0.66
111 0.67
112 0.62
113 0.57
114 0.53
115 0.55
116 0.48
117 0.49
118 0.44
119 0.36
120 0.35
121 0.34
122 0.28
123 0.22
124 0.19
125 0.14
126 0.13
127 0.11
128 0.07
129 0.06
130 0.07
131 0.06
132 0.07
133 0.07
134 0.09
135 0.11
136 0.16
137 0.16
138 0.17
139 0.18
140 0.21
141 0.25
142 0.3
143 0.32
144 0.37
145 0.39
146 0.43
147 0.49
148 0.49
149 0.52
150 0.54
151 0.6
152 0.61
153 0.7
154 0.76
155 0.79
156 0.86
157 0.9
158 0.92
159 0.92
160 0.9