Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MBH8

Protein Details
Accession A0A5C3MBH8    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
33-57GSSSAPPKRGRGRPKGSKNKKTGESBasic
64-107SAPAIPRKRGRPPKEKKEETGEEPPPKRPRGRPRKNPKPETADEBasic
NLS Segment(s)
PositionSequence
38-102PPKRGRGRPKGSKNKKTGESSAAASASAPAIPRKRGRPPKEKKEETGEEPPPKRPRGRPRKNPKP
116-127PSAKKKRGRPKK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSSSPKEPQDDGADRQSVDELDDTQADGDAEPGSSSAPPKRGRGRPKGSKNKKTGESSAAASASAPAIPRKRGRPPKEKKEETGEEPPPKRPRGRPRKNPKPETADEATSGDAAEPSAKKKRGRPKKTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.33
4 0.24
5 0.2
6 0.17
7 0.12
8 0.12
9 0.12
10 0.11
11 0.1
12 0.1
13 0.09
14 0.08
15 0.07
16 0.06
17 0.06
18 0.05
19 0.05
20 0.06
21 0.06
22 0.09
23 0.11
24 0.18
25 0.21
26 0.28
27 0.37
28 0.45
29 0.53
30 0.61
31 0.68
32 0.72
33 0.8
34 0.85
35 0.87
36 0.88
37 0.86
38 0.83
39 0.8
40 0.74
41 0.66
42 0.59
43 0.5
44 0.42
45 0.36
46 0.28
47 0.21
48 0.16
49 0.13
50 0.09
51 0.07
52 0.06
53 0.08
54 0.1
55 0.13
56 0.17
57 0.22
58 0.32
59 0.42
60 0.51
61 0.59
62 0.67
63 0.75
64 0.82
65 0.82
66 0.75
67 0.74
68 0.7
69 0.65
70 0.63
71 0.6
72 0.57
73 0.55
74 0.59
75 0.57
76 0.57
77 0.57
78 0.58
79 0.62
80 0.65
81 0.74
82 0.77
83 0.82
84 0.89
85 0.93
86 0.92
87 0.9
88 0.87
89 0.8
90 0.76
91 0.69
92 0.6
93 0.51
94 0.43
95 0.35
96 0.26
97 0.22
98 0.15
99 0.1
100 0.08
101 0.11
102 0.11
103 0.16
104 0.25
105 0.31
106 0.37
107 0.46
108 0.57
109 0.64
110 0.74