Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5FH02

Protein Details
Accession C5FH02    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
148-175KARLVWEKYKAIKKQKKRKAAELSSSSTHydrophilic
NLS Segment(s)
PositionSequence
138-167KEERMAAERDKARLVWEKYKAIKKQKKRKA
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MTSSNDDGQSNGNFEGYVFKSCLDAAVVVDEKFYGPLPDVVSMQGRFLRPRPETPTFDPEYYPDFARKLAFLLDGVPFRQKVRRRKYGEEIVEEWIEGHTPIEIREKWISEQEKKMKQHDAILENPTPPTPEDERRAKEERMAAERDKARLVWEKYKAIKKQKKRKAAELSSSSTQTLPNPRKRQMPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.17
4 0.18
5 0.16
6 0.16
7 0.17
8 0.17
9 0.18
10 0.12
11 0.11
12 0.09
13 0.13
14 0.14
15 0.13
16 0.13
17 0.12
18 0.12
19 0.12
20 0.12
21 0.08
22 0.08
23 0.1
24 0.12
25 0.13
26 0.13
27 0.14
28 0.17
29 0.17
30 0.17
31 0.18
32 0.19
33 0.2
34 0.23
35 0.3
36 0.29
37 0.35
38 0.41
39 0.45
40 0.49
41 0.52
42 0.56
43 0.51
44 0.49
45 0.44
46 0.37
47 0.34
48 0.3
49 0.25
50 0.2
51 0.16
52 0.16
53 0.16
54 0.15
55 0.12
56 0.11
57 0.1
58 0.08
59 0.09
60 0.1
61 0.1
62 0.11
63 0.12
64 0.11
65 0.12
66 0.19
67 0.25
68 0.34
69 0.42
70 0.52
71 0.57
72 0.63
73 0.69
74 0.72
75 0.68
76 0.62
77 0.54
78 0.47
79 0.4
80 0.33
81 0.25
82 0.16
83 0.12
84 0.08
85 0.06
86 0.04
87 0.04
88 0.05
89 0.1
90 0.1
91 0.13
92 0.15
93 0.16
94 0.17
95 0.23
96 0.27
97 0.27
98 0.36
99 0.41
100 0.47
101 0.49
102 0.52
103 0.51
104 0.47
105 0.48
106 0.46
107 0.41
108 0.37
109 0.39
110 0.36
111 0.31
112 0.3
113 0.25
114 0.2
115 0.16
116 0.18
117 0.19
118 0.23
119 0.29
120 0.37
121 0.4
122 0.45
123 0.5
124 0.45
125 0.45
126 0.44
127 0.43
128 0.4
129 0.42
130 0.37
131 0.4
132 0.42
133 0.39
134 0.36
135 0.31
136 0.3
137 0.34
138 0.38
139 0.38
140 0.41
141 0.47
142 0.53
143 0.62
144 0.66
145 0.68
146 0.73
147 0.76
148 0.81
149 0.84
150 0.87
151 0.86
152 0.87
153 0.87
154 0.86
155 0.86
156 0.81
157 0.78
158 0.71
159 0.66
160 0.56
161 0.46
162 0.38
163 0.33
164 0.37
165 0.4
166 0.47
167 0.53
168 0.58