Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3M9V6

Protein Details
Accession A0A5C3M9V6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
118-139EEEEEKPKKKAKKTAAKKADESBasic
NLS Segment(s)
PositionSequence
123-157KPKKKAKKTAAKKADESEGESAAEKPKKARASKAK
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0016874  F:ligase activity  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00645  zf-PARP  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MAEKPSGYRLEYATSARAKCKGPAPCKGTTIQKGEFRVGTLVDFRGNTSFAYRHWGCTTPKIFENMKKSFEDPSELDGYDDLKPEDQAKVKESWQQGHVAEGDIPASAKKDDGAAEGEEEEEKPKKKAKKTAAKKADESEGESAAEKPKKARASKAKVGLNLPYPTSCAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.34
4 0.37
5 0.35
6 0.36
7 0.41
8 0.45
9 0.45
10 0.53
11 0.55
12 0.54
13 0.55
14 0.55
15 0.56
16 0.54
17 0.54
18 0.5
19 0.5
20 0.49
21 0.49
22 0.45
23 0.37
24 0.31
25 0.25
26 0.2
27 0.17
28 0.15
29 0.13
30 0.13
31 0.13
32 0.13
33 0.13
34 0.12
35 0.13
36 0.13
37 0.11
38 0.2
39 0.19
40 0.21
41 0.23
42 0.27
43 0.26
44 0.34
45 0.36
46 0.31
47 0.32
48 0.33
49 0.34
50 0.35
51 0.42
52 0.37
53 0.38
54 0.36
55 0.35
56 0.33
57 0.31
58 0.29
59 0.22
60 0.22
61 0.21
62 0.19
63 0.18
64 0.15
65 0.16
66 0.13
67 0.13
68 0.09
69 0.07
70 0.08
71 0.09
72 0.11
73 0.12
74 0.13
75 0.14
76 0.16
77 0.17
78 0.23
79 0.24
80 0.24
81 0.22
82 0.25
83 0.22
84 0.22
85 0.21
86 0.16
87 0.14
88 0.11
89 0.1
90 0.07
91 0.07
92 0.05
93 0.06
94 0.06
95 0.05
96 0.06
97 0.07
98 0.07
99 0.09
100 0.11
101 0.1
102 0.1
103 0.1
104 0.11
105 0.1
106 0.1
107 0.11
108 0.13
109 0.15
110 0.17
111 0.24
112 0.31
113 0.38
114 0.48
115 0.56
116 0.63
117 0.72
118 0.81
119 0.84
120 0.83
121 0.79
122 0.73
123 0.7
124 0.6
125 0.53
126 0.44
127 0.35
128 0.29
129 0.26
130 0.24
131 0.24
132 0.26
133 0.23
134 0.23
135 0.3
136 0.38
137 0.41
138 0.51
139 0.54
140 0.61
141 0.69
142 0.75
143 0.73
144 0.69
145 0.68
146 0.63
147 0.59
148 0.52
149 0.45
150 0.37