Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3M2Y2

Protein Details
Accession A0A5C3M2Y2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
103-122RTTRRGCTLRRARERCCFSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 5, extr 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MKLCIFLPSCVRALLADGHSCYIQRRNGECKCKSVKSLSSARISLSLCVISSSMARMRSRVDGHRPPPASWTKACHESEEVLRFLERRMTGSMWSGWRFRAGRTTRRGCTLRRARERCCFSSARLISIHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.18
4 0.18
5 0.19
6 0.19
7 0.2
8 0.21
9 0.22
10 0.24
11 0.28
12 0.32
13 0.4
14 0.49
15 0.58
16 0.57
17 0.59
18 0.62
19 0.59
20 0.58
21 0.55
22 0.52
23 0.49
24 0.54
25 0.51
26 0.48
27 0.45
28 0.42
29 0.39
30 0.34
31 0.28
32 0.21
33 0.16
34 0.11
35 0.11
36 0.11
37 0.07
38 0.07
39 0.08
40 0.09
41 0.13
42 0.13
43 0.13
44 0.15
45 0.19
46 0.22
47 0.25
48 0.3
49 0.34
50 0.37
51 0.43
52 0.43
53 0.39
54 0.42
55 0.41
56 0.36
57 0.3
58 0.32
59 0.28
60 0.34
61 0.34
62 0.3
63 0.28
64 0.26
65 0.29
66 0.28
67 0.25
68 0.18
69 0.18
70 0.16
71 0.15
72 0.18
73 0.14
74 0.14
75 0.16
76 0.16
77 0.17
78 0.19
79 0.22
80 0.21
81 0.23
82 0.22
83 0.2
84 0.26
85 0.26
86 0.24
87 0.31
88 0.33
89 0.39
90 0.48
91 0.56
92 0.52
93 0.6
94 0.63
95 0.56
96 0.61
97 0.63
98 0.64
99 0.67
100 0.71
101 0.7
102 0.76
103 0.81
104 0.74
105 0.7
106 0.62
107 0.54
108 0.58
109 0.53
110 0.46