Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3LVE8

Protein Details
Accession A0A5C3LVE8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-82FTRRSDCTRHERNKHNLLPRRKRESKTPSLNHydrophilic
NLS Segment(s)
PositionSequence
72-73RK
Subcellular Location(s) nucl 21, cyto_nucl 13.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MLARNDNRTIFCCNIEGCGSTFTESHNLKGHMRAHNGIKDQFCSMPGCDAAFTRRSDCTRHERNKHNLLPRRKRESKTPSLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.22
4 0.17
5 0.17
6 0.15
7 0.14
8 0.14
9 0.13
10 0.19
11 0.19
12 0.2
13 0.23
14 0.24
15 0.24
16 0.3
17 0.34
18 0.31
19 0.34
20 0.35
21 0.34
22 0.36
23 0.38
24 0.36
25 0.31
26 0.27
27 0.25
28 0.22
29 0.19
30 0.16
31 0.14
32 0.11
33 0.11
34 0.1
35 0.09
36 0.1
37 0.11
38 0.13
39 0.14
40 0.15
41 0.19
42 0.2
43 0.23
44 0.28
45 0.35
46 0.42
47 0.51
48 0.58
49 0.64
50 0.71
51 0.79
52 0.81
53 0.82
54 0.8
55 0.82
56 0.84
57 0.85
58 0.86
59 0.84
60 0.81
61 0.81
62 0.82