Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LRI2

Protein Details
Accession A0A5C3LRI2    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-107EDVTEKKKRGKGAPKKAKTKADSRRLHKRRBasic
NLS Segment(s)
PositionSequence
83-107KKKRGKGAPKKAKTKADSRRLHKRR
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAAPVSASRLASIVKQRCSIFQTAYNPTNARTGAKYLRARLRGPSMVRYYPQTINISQIARQYPELEICDESEAERFEDVTEKKKRGKGAPKKAKTKADSRRLHKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.37
4 0.39
5 0.43
6 0.41
7 0.35
8 0.34
9 0.37
10 0.39
11 0.4
12 0.4
13 0.37
14 0.35
15 0.35
16 0.29
17 0.25
18 0.2
19 0.22
20 0.22
21 0.3
22 0.33
23 0.36
24 0.42
25 0.44
26 0.44
27 0.43
28 0.45
29 0.42
30 0.4
31 0.4
32 0.37
33 0.34
34 0.34
35 0.33
36 0.31
37 0.27
38 0.29
39 0.25
40 0.21
41 0.22
42 0.24
43 0.21
44 0.18
45 0.2
46 0.18
47 0.16
48 0.17
49 0.15
50 0.14
51 0.15
52 0.15
53 0.13
54 0.13
55 0.12
56 0.13
57 0.12
58 0.11
59 0.11
60 0.1
61 0.1
62 0.09
63 0.09
64 0.08
65 0.15
66 0.16
67 0.23
68 0.29
69 0.33
70 0.39
71 0.43
72 0.49
73 0.52
74 0.62
75 0.65
76 0.7
77 0.77
78 0.8
79 0.86
80 0.89
81 0.88
82 0.83
83 0.82
84 0.82
85 0.81
86 0.81
87 0.8