Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FFC8

Protein Details
Accession C5FFC8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
164-183RRAREEKKALDKKERKERDEBasic
NLS Segment(s)
PositionSequence
161-181KEERRAREEKKALDKKERKER
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MLLAPPILELDQSESFSGLLTPALSFASLVPCRQSVKCPRLPSSPERRELGEYTQGVARGLRTADQGKFYRRHVLISGAYRLTKVGNKKDNVTVIYTPWSNLHKTAAMATGQVSFHNPKLTRKVFVPQRQNPIVNRLNKTRVEKFPDLRAEKEEYLAQCRKEERRAREEKKALDKKERKERDELRWQKEHAYDDLMSPDSVQQSNNQDRDESYLDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.14
5 0.09
6 0.07
7 0.07
8 0.06
9 0.06
10 0.07
11 0.07
12 0.07
13 0.07
14 0.14
15 0.15
16 0.16
17 0.17
18 0.19
19 0.23
20 0.24
21 0.32
22 0.35
23 0.43
24 0.49
25 0.53
26 0.56
27 0.61
28 0.66
29 0.66
30 0.67
31 0.66
32 0.65
33 0.61
34 0.58
35 0.54
36 0.51
37 0.46
38 0.42
39 0.34
40 0.3
41 0.3
42 0.27
43 0.23
44 0.21
45 0.17
46 0.11
47 0.11
48 0.11
49 0.12
50 0.16
51 0.17
52 0.23
53 0.25
54 0.29
55 0.32
56 0.33
57 0.39
58 0.35
59 0.36
60 0.31
61 0.33
62 0.31
63 0.31
64 0.32
65 0.25
66 0.25
67 0.22
68 0.21
69 0.18
70 0.18
71 0.21
72 0.26
73 0.32
74 0.34
75 0.36
76 0.39
77 0.41
78 0.38
79 0.35
80 0.27
81 0.21
82 0.21
83 0.19
84 0.16
85 0.16
86 0.16
87 0.14
88 0.14
89 0.14
90 0.12
91 0.12
92 0.13
93 0.12
94 0.1
95 0.09
96 0.09
97 0.09
98 0.09
99 0.09
100 0.1
101 0.1
102 0.11
103 0.16
104 0.17
105 0.18
106 0.27
107 0.28
108 0.28
109 0.29
110 0.36
111 0.4
112 0.47
113 0.54
114 0.51
115 0.58
116 0.6
117 0.62
118 0.55
119 0.54
120 0.52
121 0.48
122 0.46
123 0.43
124 0.45
125 0.46
126 0.51
127 0.5
128 0.5
129 0.52
130 0.54
131 0.52
132 0.54
133 0.58
134 0.55
135 0.49
136 0.47
137 0.43
138 0.38
139 0.37
140 0.33
141 0.25
142 0.29
143 0.32
144 0.29
145 0.27
146 0.32
147 0.36
148 0.42
149 0.49
150 0.5
151 0.56
152 0.66
153 0.69
154 0.74
155 0.76
156 0.75
157 0.77
158 0.78
159 0.74
160 0.74
161 0.76
162 0.76
163 0.8
164 0.81
165 0.74
166 0.75
167 0.77
168 0.75
169 0.79
170 0.78
171 0.75
172 0.73
173 0.7
174 0.66
175 0.63
176 0.57
177 0.48
178 0.43
179 0.36
180 0.3
181 0.32
182 0.27
183 0.22
184 0.19
185 0.19
186 0.18
187 0.18
188 0.17
189 0.2
190 0.28
191 0.37
192 0.4
193 0.39
194 0.36
195 0.36
196 0.42
197 0.4
198 0.34