Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3LKI2

Protein Details
Accession A0A5C3LKI2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-90FQAYRDCKKTWIKQRKEDRRAGRPTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, pero 2, mito 1, golg 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MAVEKEETKTTVPNPEDLKPLDYKEQFSGREVTSRFIDPCAAASKASMDCLNRNNYDRDACLDYFQAYRDCKKTWIKQRKEDRRAGRPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.38
4 0.36
5 0.37
6 0.31
7 0.32
8 0.34
9 0.32
10 0.32
11 0.32
12 0.35
13 0.33
14 0.32
15 0.33
16 0.26
17 0.29
18 0.27
19 0.25
20 0.23
21 0.23
22 0.22
23 0.18
24 0.19
25 0.13
26 0.14
27 0.14
28 0.12
29 0.1
30 0.1
31 0.11
32 0.11
33 0.12
34 0.11
35 0.1
36 0.12
37 0.16
38 0.2
39 0.2
40 0.22
41 0.24
42 0.25
43 0.26
44 0.24
45 0.24
46 0.24
47 0.22
48 0.21
49 0.19
50 0.19
51 0.18
52 0.19
53 0.2
54 0.18
55 0.23
56 0.26
57 0.26
58 0.32
59 0.41
60 0.49
61 0.55
62 0.64
63 0.68
64 0.74
65 0.84
66 0.89
67 0.89
68 0.89
69 0.88
70 0.87