Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MIT9

Protein Details
Accession A0A5C3MIT9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
211-233DDRRPERRTTRSRGSTKRRDSSABasic
NLS Segment(s)
PositionSequence
142-162IKEKASPRKKRVGGGAKRKRK
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSIRRKPISTYKSPSGGEWNPYLFAACTKSSTSSLQSHVQSKPRTPIMEEKPTGNQHLRRQKYLSGPSLPLYHPLGRLALSLPPLDPAAFGLPVPIMKDDPEPRSSARPRKQATKLRDVEDEFPTPMPSVSTIAAVAAREIKEKASPRKKRVGGGAKRKRKEADDGDATYPAKRTRVPRGMTNQMAEEEESPEAAIPAPDIVTTPEPAGDDRRPERRTTRSRGSTKRRDSSASANASLSISPPAVIAELLPVASAAEEAEEKTTCVDRDLPCDDSPGRRVTKEIIEEKEEGELSEEGQVGSGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.6
3 0.58
4 0.53
5 0.48
6 0.43
7 0.38
8 0.32
9 0.31
10 0.3
11 0.21
12 0.2
13 0.19
14 0.17
15 0.17
16 0.18
17 0.21
18 0.22
19 0.25
20 0.28
21 0.28
22 0.31
23 0.35
24 0.38
25 0.4
26 0.44
27 0.49
28 0.48
29 0.49
30 0.52
31 0.51
32 0.49
33 0.48
34 0.52
35 0.52
36 0.58
37 0.54
38 0.5
39 0.51
40 0.52
41 0.54
42 0.51
43 0.49
44 0.49
45 0.58
46 0.6
47 0.58
48 0.59
49 0.59
50 0.6
51 0.61
52 0.58
53 0.52
54 0.49
55 0.46
56 0.46
57 0.4
58 0.35
59 0.31
60 0.27
61 0.24
62 0.22
63 0.21
64 0.18
65 0.18
66 0.16
67 0.14
68 0.13
69 0.12
70 0.11
71 0.12
72 0.12
73 0.11
74 0.1
75 0.09
76 0.09
77 0.08
78 0.08
79 0.07
80 0.07
81 0.08
82 0.09
83 0.08
84 0.07
85 0.08
86 0.13
87 0.17
88 0.2
89 0.22
90 0.23
91 0.24
92 0.32
93 0.39
94 0.45
95 0.48
96 0.54
97 0.56
98 0.63
99 0.71
100 0.71
101 0.7
102 0.71
103 0.68
104 0.61
105 0.62
106 0.56
107 0.5
108 0.44
109 0.39
110 0.29
111 0.24
112 0.22
113 0.17
114 0.15
115 0.11
116 0.09
117 0.08
118 0.08
119 0.08
120 0.07
121 0.07
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.08
128 0.08
129 0.09
130 0.13
131 0.18
132 0.28
133 0.37
134 0.45
135 0.49
136 0.58
137 0.6
138 0.59
139 0.63
140 0.64
141 0.62
142 0.66
143 0.71
144 0.7
145 0.7
146 0.7
147 0.63
148 0.55
149 0.54
150 0.48
151 0.45
152 0.41
153 0.42
154 0.39
155 0.39
156 0.37
157 0.29
158 0.26
159 0.19
160 0.15
161 0.16
162 0.2
163 0.28
164 0.36
165 0.38
166 0.43
167 0.49
168 0.54
169 0.53
170 0.49
171 0.4
172 0.33
173 0.31
174 0.25
175 0.18
176 0.13
177 0.1
178 0.09
179 0.08
180 0.07
181 0.07
182 0.06
183 0.05
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.06
190 0.07
191 0.08
192 0.08
193 0.09
194 0.09
195 0.1
196 0.15
197 0.15
198 0.21
199 0.25
200 0.34
201 0.35
202 0.39
203 0.45
204 0.5
205 0.57
206 0.59
207 0.65
208 0.66
209 0.74
210 0.8
211 0.83
212 0.84
213 0.85
214 0.83
215 0.76
216 0.71
217 0.65
218 0.63
219 0.61
220 0.55
221 0.47
222 0.4
223 0.37
224 0.33
225 0.29
226 0.22
227 0.14
228 0.1
229 0.08
230 0.08
231 0.08
232 0.07
233 0.07
234 0.06
235 0.06
236 0.06
237 0.06
238 0.06
239 0.05
240 0.05
241 0.05
242 0.05
243 0.03
244 0.04
245 0.05
246 0.06
247 0.08
248 0.08
249 0.08
250 0.11
251 0.13
252 0.13
253 0.15
254 0.21
255 0.2
256 0.27
257 0.3
258 0.33
259 0.3
260 0.35
261 0.35
262 0.34
263 0.36
264 0.37
265 0.37
266 0.33
267 0.35
268 0.36
269 0.41
270 0.45
271 0.48
272 0.45
273 0.46
274 0.47
275 0.45
276 0.44
277 0.36
278 0.27
279 0.24
280 0.19
281 0.15
282 0.17
283 0.16
284 0.12