Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3M1X0

Protein Details
Accession A0A5C3M1X0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-44TKPICRRSLCRHPLCRRPLCCHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 5, vacu 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPYLSMSLLSMPVAILCCLNYVTKPICRRSLCRHPLCRRPLCCCHYTVAVLFLVFLCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.06
5 0.07
6 0.07
7 0.08
8 0.07
9 0.1
10 0.13
11 0.18
12 0.23
13 0.26
14 0.33
15 0.35
16 0.4
17 0.46
18 0.54
19 0.58
20 0.62
21 0.69
22 0.69
23 0.76
24 0.8
25 0.8
26 0.74
27 0.72
28 0.73
29 0.68
30 0.62
31 0.55
32 0.49
33 0.43
34 0.41
35 0.34
36 0.27
37 0.22
38 0.19
39 0.18