Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LY56

Protein Details
Accession A0A5C3LY56    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
215-246RTLSLKPQPKVRCPKKLRRRAREQYVRDRKSEBasic
NLS Segment(s)
PositionSequence
222-236QPKVRCPKKLRRRAR
Subcellular Location(s) plas 10, mito 7, nucl 3, cyto 3, cyto_nucl 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MARKELDVIHLRARLIIIEWNIVRQISIEIDKGLSEKGLFRQVGSRYFLSRYRHQHDPLIGVMANDRSSVPSAENVCTSMRLNNEAVSHANIVSEVAVLVLVLVVVIVVVMKVISVGVEPETRMSGGGGGETPGAAPTCALRHFPPPTSPRNKTTTSTPFLVPSNTLILSSITRSSICTVVCFPTPTIGAGAACTMILFNSFGAACPPLPRGSPRTLSLKPQPKVRCPKKLRRRAREQYVRDRKSEALHELVLVWVGESSEDWLECDDMEEEELMEGKKWEAGICTRGGTSSVCSVGAVKAARRRRMGFFWMKGGGSGGTEKETLAIVVAKPTLGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.23
4 0.18
5 0.21
6 0.21
7 0.22
8 0.23
9 0.22
10 0.2
11 0.16
12 0.16
13 0.14
14 0.16
15 0.16
16 0.15
17 0.16
18 0.16
19 0.16
20 0.15
21 0.12
22 0.11
23 0.12
24 0.15
25 0.23
26 0.22
27 0.22
28 0.29
29 0.32
30 0.36
31 0.38
32 0.36
33 0.31
34 0.35
35 0.4
36 0.4
37 0.44
38 0.49
39 0.5
40 0.55
41 0.56
42 0.59
43 0.56
44 0.52
45 0.45
46 0.39
47 0.33
48 0.26
49 0.24
50 0.2
51 0.17
52 0.14
53 0.13
54 0.11
55 0.12
56 0.13
57 0.12
58 0.15
59 0.18
60 0.19
61 0.19
62 0.19
63 0.18
64 0.19
65 0.19
66 0.17
67 0.16
68 0.18
69 0.18
70 0.19
71 0.19
72 0.19
73 0.2
74 0.18
75 0.17
76 0.14
77 0.13
78 0.11
79 0.1
80 0.08
81 0.07
82 0.05
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.02
89 0.02
90 0.02
91 0.01
92 0.01
93 0.01
94 0.01
95 0.01
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.03
104 0.05
105 0.05
106 0.06
107 0.06
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.04
125 0.06
126 0.07
127 0.09
128 0.1
129 0.16
130 0.19
131 0.2
132 0.26
133 0.29
134 0.37
135 0.44
136 0.47
137 0.46
138 0.49
139 0.5
140 0.45
141 0.48
142 0.46
143 0.41
144 0.4
145 0.36
146 0.32
147 0.3
148 0.29
149 0.21
150 0.15
151 0.13
152 0.11
153 0.1
154 0.08
155 0.08
156 0.08
157 0.09
158 0.08
159 0.07
160 0.07
161 0.08
162 0.09
163 0.1
164 0.1
165 0.1
166 0.11
167 0.12
168 0.13
169 0.13
170 0.12
171 0.11
172 0.11
173 0.11
174 0.1
175 0.08
176 0.07
177 0.07
178 0.07
179 0.05
180 0.05
181 0.04
182 0.03
183 0.03
184 0.04
185 0.04
186 0.03
187 0.04
188 0.04
189 0.05
190 0.06
191 0.07
192 0.06
193 0.08
194 0.09
195 0.1
196 0.11
197 0.14
198 0.18
199 0.22
200 0.25
201 0.26
202 0.32
203 0.33
204 0.38
205 0.44
206 0.5
207 0.48
208 0.53
209 0.56
210 0.58
211 0.68
212 0.7
213 0.72
214 0.72
215 0.81
216 0.83
217 0.88
218 0.89
219 0.89
220 0.91
221 0.9
222 0.92
223 0.91
224 0.89
225 0.9
226 0.9
227 0.83
228 0.74
229 0.66
230 0.57
231 0.51
232 0.47
233 0.39
234 0.31
235 0.28
236 0.26
237 0.23
238 0.21
239 0.17
240 0.12
241 0.08
242 0.05
243 0.05
244 0.04
245 0.04
246 0.06
247 0.07
248 0.07
249 0.07
250 0.08
251 0.08
252 0.08
253 0.09
254 0.08
255 0.07
256 0.08
257 0.08
258 0.07
259 0.07
260 0.09
261 0.08
262 0.08
263 0.08
264 0.08
265 0.09
266 0.09
267 0.1
268 0.12
269 0.15
270 0.17
271 0.18
272 0.19
273 0.18
274 0.18
275 0.19
276 0.17
277 0.16
278 0.16
279 0.15
280 0.14
281 0.14
282 0.15
283 0.14
284 0.18
285 0.17
286 0.19
287 0.26
288 0.35
289 0.42
290 0.47
291 0.51
292 0.53
293 0.57
294 0.62
295 0.63
296 0.59
297 0.58
298 0.55
299 0.51
300 0.45
301 0.4
302 0.31
303 0.23
304 0.21
305 0.16
306 0.15
307 0.15
308 0.14
309 0.14
310 0.14
311 0.12
312 0.11
313 0.12
314 0.1
315 0.13
316 0.13