Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3LP46

Protein Details
Accession A0A5C3LP46    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-35RCQYSRENCKPGRRVRRPPGSQPEKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences RPRNAFLIFRCQYSRENCKPGRRVRRPPGSQPEKTLSKRAAEAWHQLPAEEKERYKVLAEEEGKEHARLHPDYRFRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.55
4 0.58
5 0.65
6 0.71
7 0.75
8 0.79
9 0.79
10 0.82
11 0.82
12 0.87
13 0.84
14 0.85
15 0.85
16 0.82
17 0.74
18 0.68
19 0.64
20 0.61
21 0.57
22 0.52
23 0.43
24 0.35
25 0.34
26 0.32
27 0.3
28 0.25
29 0.28
30 0.25
31 0.27
32 0.26
33 0.25
34 0.25
35 0.24
36 0.26
37 0.24
38 0.23
39 0.21
40 0.22
41 0.24
42 0.22
43 0.21
44 0.19
45 0.25
46 0.26
47 0.26
48 0.27
49 0.3
50 0.3
51 0.29
52 0.28
53 0.22
54 0.27
55 0.27
56 0.3
57 0.34