Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MDC6

Protein Details
Accession A0A5C3MDC6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
119-138ECSKQYRTLRCRCYSKNARIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6, cyto_nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011011  Znf_FYVE_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Amino Acid Sequences MSARSLNITPGGVTLITGPPKALCICDFIVDDHYDDLIVTCHTCNRSCHAVCFSIEDKALIPGIWRCWVCFPRRIDKGRAVRLQQDRQARIEVMTRNKQLEDLSAQEIPEYREGASLEECSKQYRTLRCRCYSKNARI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.14
4 0.14
5 0.14
6 0.13
7 0.16
8 0.16
9 0.16
10 0.12
11 0.15
12 0.15
13 0.17
14 0.18
15 0.17
16 0.19
17 0.18
18 0.18
19 0.14
20 0.13
21 0.11
22 0.1
23 0.09
24 0.07
25 0.06
26 0.06
27 0.06
28 0.09
29 0.11
30 0.14
31 0.15
32 0.19
33 0.27
34 0.27
35 0.3
36 0.3
37 0.3
38 0.28
39 0.31
40 0.27
41 0.21
42 0.2
43 0.18
44 0.15
45 0.13
46 0.13
47 0.08
48 0.08
49 0.07
50 0.08
51 0.12
52 0.11
53 0.11
54 0.16
55 0.2
56 0.21
57 0.26
58 0.29
59 0.34
60 0.41
61 0.45
62 0.44
63 0.49
64 0.55
65 0.57
66 0.58
67 0.52
68 0.53
69 0.56
70 0.57
71 0.54
72 0.54
73 0.48
74 0.45
75 0.45
76 0.37
77 0.3
78 0.3
79 0.3
80 0.3
81 0.35
82 0.35
83 0.35
84 0.34
85 0.35
86 0.3
87 0.27
88 0.23
89 0.19
90 0.19
91 0.19
92 0.19
93 0.18
94 0.19
95 0.18
96 0.17
97 0.15
98 0.12
99 0.13
100 0.14
101 0.15
102 0.16
103 0.16
104 0.16
105 0.18
106 0.19
107 0.2
108 0.21
109 0.25
110 0.3
111 0.37
112 0.45
113 0.52
114 0.61
115 0.67
116 0.75
117 0.75
118 0.79