Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MDZ3

Protein Details
Accession A0A5C3MDZ3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSDTKQCRTKRDLKFVRCESHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 5, mito 4, pero 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045338  DUF6535  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20153  DUF6535  
Amino Acid Sequences MSDTKQCRTKRDLKFVRCESLIKWQIPNILRGLPILLQLALVLFFLGMQDLLRSLDPIITIVLSVIVGLVLFITVATTIIPGLQLRLLFLRHSSSWSNCPYKSPQSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.77
4 0.69
5 0.61
6 0.51
7 0.52
8 0.5
9 0.42
10 0.38
11 0.34
12 0.38
13 0.38
14 0.38
15 0.29
16 0.24
17 0.22
18 0.2
19 0.2
20 0.13
21 0.13
22 0.11
23 0.09
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.03
30 0.02
31 0.02
32 0.02
33 0.03
34 0.02
35 0.02
36 0.02
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.05
70 0.07
71 0.07
72 0.08
73 0.1
74 0.11
75 0.11
76 0.12
77 0.17
78 0.16
79 0.2
80 0.24
81 0.26
82 0.31
83 0.39
84 0.43
85 0.39
86 0.44
87 0.47