Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MDX5

Protein Details
Accession A0A5C3MDX5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-122PLDLRTKKTRAIRRRMTKNEKSLKTLKQRKKDLNFPTRKYAVHydrophilic
NLS Segment(s)
PositionSequence
85-112RTKKTRAIRRRMTKNEKSLKTLKQRKKD
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLLELKNELLTLRVQKIAGGSASKLTKISTVRKSIARVLTVMNQKARQNLREYYKDKKFLPLDLRTKKTRAIRRRMTKNEKSLKTLKQRKKDLNFPTRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.53
9 0.5
10 0.47
11 0.46
12 0.38
13 0.33
14 0.28
15 0.25
16 0.16
17 0.15
18 0.17
19 0.17
20 0.17
21 0.16
22 0.16
23 0.16
24 0.16
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.13
32 0.12
33 0.15
34 0.18
35 0.25
36 0.27
37 0.31
38 0.33
39 0.36
40 0.38
41 0.39
42 0.38
43 0.31
44 0.26
45 0.23
46 0.26
47 0.27
48 0.27
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.28
55 0.28
56 0.31
57 0.35
58 0.4
59 0.43
60 0.45
61 0.49
62 0.52
63 0.48
64 0.51
65 0.47
66 0.44
67 0.49
68 0.49
69 0.52
70 0.55
71 0.6
72 0.55
73 0.56
74 0.56
75 0.58
76 0.59
77 0.59
78 0.62
79 0.67
80 0.74
81 0.83
82 0.88
83 0.89
84 0.88
85 0.89
86 0.88
87 0.82
88 0.78
89 0.75
90 0.73
91 0.74
92 0.76
93 0.75
94 0.74
95 0.81
96 0.84
97 0.85
98 0.86
99 0.85
100 0.86
101 0.87
102 0.82
103 0.81
104 0.76