Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3M1A9

Protein Details
Accession A0A5C3M1A9    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-25DTTPKKAQPHPSKRIPPSPGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 7.833, mito 7.5, nucl 7, cyto_nucl 6.833, cyto 5.5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MTSDMDTTPKKAQPHPSKRIPPSPGIFNYSRSAGPIAPFQVFGFAVNLETMRNWVNLHLGPQTWGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.77
5 0.79
6 0.81
7 0.74
8 0.7
9 0.63
10 0.61
11 0.53
12 0.48
13 0.43
14 0.37
15 0.35
16 0.3
17 0.26
18 0.2
19 0.19
20 0.14
21 0.14
22 0.13
23 0.13
24 0.11
25 0.12
26 0.11
27 0.11
28 0.11
29 0.1
30 0.09
31 0.07
32 0.08
33 0.07
34 0.08
35 0.06
36 0.06
37 0.08
38 0.08
39 0.09
40 0.09
41 0.1
42 0.14
43 0.15
44 0.17
45 0.18
46 0.18