Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FSQ9

Protein Details
Accession C5FSQ9    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
90-121KRLCEGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLGLRSLLSPPSKLPLSQFTSALPRRICQTVFLRPFSQGFGATLSTRSIWNTSEAMSTGLKNLCSRSVKAFGSMSAIGQTRGMKTRSSVKRLCEGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.33
4 0.34
5 0.34
6 0.3
7 0.38
8 0.4
9 0.43
10 0.35
11 0.31
12 0.32
13 0.35
14 0.33
15 0.3
16 0.32
17 0.36
18 0.4
19 0.42
20 0.4
21 0.38
22 0.38
23 0.34
24 0.29
25 0.19
26 0.15
27 0.13
28 0.13
29 0.12
30 0.12
31 0.11
32 0.1
33 0.1
34 0.11
35 0.1
36 0.1
37 0.11
38 0.11
39 0.11
40 0.11
41 0.11
42 0.12
43 0.11
44 0.1
45 0.1
46 0.11
47 0.11
48 0.11
49 0.11
50 0.14
51 0.16
52 0.17
53 0.19
54 0.22
55 0.22
56 0.24
57 0.23
58 0.19
59 0.2
60 0.19
61 0.16
62 0.13
63 0.13
64 0.11
65 0.13
66 0.13
67 0.12
68 0.16
69 0.17
70 0.15
71 0.17
72 0.27
73 0.33
74 0.4
75 0.42
76 0.42
77 0.5
78 0.53
79 0.55
80 0.53
81 0.53
82 0.55
83 0.61
84 0.65
85 0.67
86 0.73
87 0.78
88 0.77
89 0.8
90 0.81
91 0.79
92 0.78
93 0.79
94 0.77
95 0.77
96 0.79
97 0.75
98 0.75
99 0.78
100 0.81
101 0.82