Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S3J6L2

Protein Details
Accession A0A4S3J6L2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MPPTSQNVKKRKSSKHDRTGCLTCRYRRKKCTENTFPACGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPPTSQNVKKRKSSKHDRTGCLTCRYRRKKCTENTFPACGACIRLNLECVRETRRQVVPSTNTFVDRTGSELDVTSISHAHMLDTFHYDWLPGTQNIETSSRRRYAMKYYIKVLAELLTVSRKYNSFLSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.89
4 0.85
5 0.83
6 0.81
7 0.76
8 0.74
9 0.71
10 0.68
11 0.69
12 0.74
13 0.76
14 0.77
15 0.8
16 0.81
17 0.83
18 0.86
19 0.85
20 0.85
21 0.81
22 0.76
23 0.67
24 0.57
25 0.48
26 0.38
27 0.3
28 0.2
29 0.16
30 0.14
31 0.14
32 0.16
33 0.16
34 0.18
35 0.16
36 0.17
37 0.21
38 0.23
39 0.24
40 0.27
41 0.3
42 0.31
43 0.31
44 0.36
45 0.35
46 0.34
47 0.36
48 0.31
49 0.28
50 0.26
51 0.24
52 0.19
53 0.15
54 0.14
55 0.11
56 0.11
57 0.1
58 0.09
59 0.09
60 0.09
61 0.09
62 0.07
63 0.06
64 0.06
65 0.07
66 0.06
67 0.06
68 0.07
69 0.08
70 0.08
71 0.12
72 0.12
73 0.12
74 0.12
75 0.11
76 0.1
77 0.12
78 0.14
79 0.11
80 0.12
81 0.12
82 0.14
83 0.16
84 0.19
85 0.2
86 0.2
87 0.26
88 0.27
89 0.28
90 0.3
91 0.32
92 0.37
93 0.44
94 0.51
95 0.49
96 0.5
97 0.55
98 0.52
99 0.49
100 0.41
101 0.32
102 0.22
103 0.19
104 0.17
105 0.16
106 0.16
107 0.17
108 0.19
109 0.19
110 0.21