Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KSQ3

Protein Details
Accession A0A5C3KSQ3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
92-115GGMAGRKQRKSDRQQAIRDRNFMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, extr 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSILHLALRSSLAGTICRRYSSTVASGTSTGTTESSKKKAAIPQSSCPPDTLLKGLNYLKGQPPVLALSDDQYPDWLWNILKPKEYPDDGPGGMAGRKQRKSDRQQAIRDRNFMSTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.23
4 0.25
5 0.25
6 0.27
7 0.29
8 0.28
9 0.3
10 0.27
11 0.27
12 0.26
13 0.26
14 0.22
15 0.2
16 0.16
17 0.13
18 0.1
19 0.11
20 0.14
21 0.18
22 0.2
23 0.23
24 0.24
25 0.27
26 0.31
27 0.38
28 0.44
29 0.45
30 0.47
31 0.53
32 0.55
33 0.51
34 0.46
35 0.4
36 0.32
37 0.27
38 0.23
39 0.17
40 0.15
41 0.18
42 0.18
43 0.18
44 0.17
45 0.18
46 0.18
47 0.18
48 0.18
49 0.14
50 0.14
51 0.13
52 0.13
53 0.12
54 0.09
55 0.09
56 0.1
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.09
63 0.09
64 0.08
65 0.11
66 0.19
67 0.2
68 0.24
69 0.24
70 0.27
71 0.31
72 0.33
73 0.32
74 0.28
75 0.3
76 0.27
77 0.26
78 0.22
79 0.19
80 0.17
81 0.17
82 0.22
83 0.26
84 0.31
85 0.37
86 0.46
87 0.55
88 0.64
89 0.72
90 0.75
91 0.76
92 0.82
93 0.87
94 0.89
95 0.85
96 0.8
97 0.72