Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KLJ1

Protein Details
Accession A0A5C3KLJ1   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-93SPIPNRRHPTNPKPKDNQNRRPAKTQNHydrophilic
NLS Segment(s)
PositionSequence
114-123KPRRRRPGPR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGAGVGQTAHSVRRIKSQESPIINHESQRISSTSTSTSTSTRLFPHSTRHQTTCPALSPRHMTNRPSPIPNRRHPTNPKPKDNQNRRPAKTQNLQPTNPRTPESLQSETCNSGKPRRRRPGPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.44
4 0.51
5 0.53
6 0.54
7 0.56
8 0.51
9 0.54
10 0.5
11 0.44
12 0.39
13 0.33
14 0.29
15 0.28
16 0.25
17 0.2
18 0.2
19 0.2
20 0.18
21 0.18
22 0.19
23 0.18
24 0.18
25 0.18
26 0.19
27 0.19
28 0.19
29 0.21
30 0.22
31 0.22
32 0.29
33 0.36
34 0.42
35 0.44
36 0.46
37 0.44
38 0.44
39 0.45
40 0.39
41 0.33
42 0.29
43 0.25
44 0.25
45 0.27
46 0.27
47 0.33
48 0.33
49 0.32
50 0.35
51 0.43
52 0.43
53 0.44
54 0.46
55 0.47
56 0.52
57 0.57
58 0.58
59 0.54
60 0.6
61 0.65
62 0.7
63 0.72
64 0.73
65 0.74
66 0.73
67 0.8
68 0.82
69 0.84
70 0.84
71 0.82
72 0.84
73 0.79
74 0.81
75 0.77
76 0.75
77 0.72
78 0.71
79 0.71
80 0.68
81 0.67
82 0.66
83 0.69
84 0.67
85 0.61
86 0.54
87 0.47
88 0.43
89 0.48
90 0.48
91 0.45
92 0.4
93 0.4
94 0.42
95 0.42
96 0.4
97 0.39
98 0.36
99 0.4
100 0.47
101 0.54
102 0.62
103 0.69