Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KRC7

Protein Details
Accession A0A5C3KRC7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-106EDVAARKKRGKGAPKKVSKKEDGRRLKKKRBasic
NLS Segment(s)
PositionSequence
81-106ARKKRGKGAPKKVSKKEDGRRLKKKR
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_mito 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MHAVIPSRLAALTRLRCSIFQTAYNPTGVRTGAKYLKAKLRGPAMAMYYPTRINLSSLIRQHPELEMVDEDEQERIEDVAARKKRGKGAPKKVSKKEDGRRLKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.32
4 0.36
5 0.39
6 0.33
7 0.3
8 0.31
9 0.33
10 0.33
11 0.34
12 0.3
13 0.24
14 0.23
15 0.2
16 0.18
17 0.13
18 0.18
19 0.2
20 0.26
21 0.28
22 0.3
23 0.37
24 0.41
25 0.42
26 0.4
27 0.41
28 0.36
29 0.35
30 0.33
31 0.28
32 0.23
33 0.22
34 0.19
35 0.16
36 0.15
37 0.14
38 0.13
39 0.1
40 0.1
41 0.12
42 0.14
43 0.17
44 0.2
45 0.22
46 0.22
47 0.23
48 0.23
49 0.2
50 0.19
51 0.14
52 0.13
53 0.11
54 0.12
55 0.12
56 0.11
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.06
63 0.06
64 0.09
65 0.11
66 0.2
67 0.25
68 0.29
69 0.34
70 0.38
71 0.46
72 0.51
73 0.6
74 0.62
75 0.69
76 0.75
77 0.81
78 0.87
79 0.88
80 0.88
81 0.87
82 0.86
83 0.85
84 0.85
85 0.86
86 0.87