Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3L7Y1

Protein Details
Accession A0A5C3L7Y1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-122PLDLRTKKTRAIRRRLTKHESSLKTLKQRKKELNFPTRKYAVHydrophilic
NLS Segment(s)
PositionSequence
85-112RTKKTRAIRRRLTKHESSLKTLKQRKKE
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKTNELQSKSKIDLSKQLAELKNELLTLRVQKIAGGSASKLTKISTVRKSIARVLTVMNQKARQNLREYYKDKKYLPLDLRTKKTRAIRRRLTKHESSLKTLKQRKKELNFPTRKYAVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.48
3 0.42
4 0.46
5 0.45
6 0.47
7 0.45
8 0.5
9 0.47
10 0.46
11 0.45
12 0.37
13 0.32
14 0.26
15 0.23
16 0.16
17 0.15
18 0.17
19 0.17
20 0.17
21 0.16
22 0.16
23 0.16
24 0.16
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.13
32 0.12
33 0.15
34 0.18
35 0.25
36 0.27
37 0.31
38 0.33
39 0.36
40 0.38
41 0.39
42 0.38
43 0.31
44 0.26
45 0.23
46 0.26
47 0.27
48 0.27
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.28
55 0.28
56 0.31
57 0.35
58 0.4
59 0.43
60 0.44
61 0.49
62 0.52
63 0.49
64 0.51
65 0.48
66 0.48
67 0.5
68 0.52
69 0.54
70 0.56
71 0.63
72 0.6
73 0.59
74 0.57
75 0.61
76 0.62
77 0.62
78 0.65
79 0.69
80 0.74
81 0.82
82 0.85
83 0.84
84 0.81
85 0.8
86 0.8
87 0.73
88 0.7
89 0.68
90 0.66
91 0.68
92 0.71
93 0.69
94 0.69
95 0.75
96 0.78
97 0.79
98 0.82
99 0.82
100 0.84
101 0.86
102 0.82
103 0.81
104 0.77