Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FRU8

Protein Details
Accession C5FRU8    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-117KPFPPGEKKRAVKKGSRRPTQSARAGBasic
NLS Segment(s)
PositionSequence
96-110PGEKKRAVKKGSRRP
Subcellular Location(s) nucl 18, extr 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MGNGSAAVLEPTYTGYVASTHDALILFEACLTGVLHHVPRRPHDRERAQLVRSGSVFIYEENASGIKRWTDGVTWSPSRILGNFLVYRELDKPFPPGEKKRAVKKGSRRPTQSARAGEPYPRLQDNGAGANGAVAAGAYSPGAPSPATAGAGVGTGFAERGQQSELERALVGSLVDSYGFKDSGLVKKTMSVTVSGVTHHLVSYYSVDDVMRGALSPPSMVESLRYIRPRQELTTKQSFRAPIEDPDQPSLDDGDPSQSLYGYRPNPAAAMSTGYYAMPPQPPYATHSSHQPHQQAQHHQQHQQQPPPPPSVPGYGVAPPQQNPYLQSPAAATSDLPPKTEEYGAYRGPASYPTAFPPSSAAPPPSHLYRTPSIPTRPSASDIPTTIDPAGSPSTSAYSRASFSLPGAMDSKPPPQQQTQQTQQQQQQQQQQTLDQRSTYPGPAPTRRESGYYDQAQAQAQAQAAHQRRTSIQQQAPQQPQPTQQPYYSNTAATGQSSYQGAPPMSTWGATHGQAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.11
5 0.14
6 0.13
7 0.12
8 0.14
9 0.14
10 0.14
11 0.14
12 0.13
13 0.1
14 0.09
15 0.09
16 0.07
17 0.08
18 0.08
19 0.07
20 0.08
21 0.11
22 0.17
23 0.21
24 0.26
25 0.3
26 0.38
27 0.47
28 0.53
29 0.59
30 0.64
31 0.69
32 0.73
33 0.78
34 0.77
35 0.7
36 0.67
37 0.6
38 0.55
39 0.46
40 0.39
41 0.29
42 0.24
43 0.23
44 0.18
45 0.19
46 0.14
47 0.14
48 0.13
49 0.14
50 0.12
51 0.12
52 0.14
53 0.12
54 0.12
55 0.14
56 0.14
57 0.15
58 0.19
59 0.23
60 0.28
61 0.29
62 0.29
63 0.29
64 0.28
65 0.29
66 0.25
67 0.24
68 0.18
69 0.22
70 0.23
71 0.23
72 0.24
73 0.23
74 0.25
75 0.23
76 0.24
77 0.21
78 0.19
79 0.23
80 0.23
81 0.3
82 0.36
83 0.41
84 0.47
85 0.55
86 0.61
87 0.67
88 0.74
89 0.73
90 0.75
91 0.78
92 0.8
93 0.81
94 0.84
95 0.8
96 0.79
97 0.81
98 0.81
99 0.79
100 0.73
101 0.67
102 0.63
103 0.58
104 0.53
105 0.49
106 0.44
107 0.4
108 0.35
109 0.32
110 0.27
111 0.28
112 0.27
113 0.25
114 0.21
115 0.16
116 0.15
117 0.13
118 0.13
119 0.09
120 0.06
121 0.03
122 0.03
123 0.02
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.04
130 0.04
131 0.05
132 0.07
133 0.08
134 0.08
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.06
146 0.06
147 0.07
148 0.08
149 0.09
150 0.1
151 0.14
152 0.14
153 0.13
154 0.13
155 0.12
156 0.11
157 0.1
158 0.09
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.05
165 0.07
166 0.07
167 0.07
168 0.09
169 0.12
170 0.18
171 0.21
172 0.2
173 0.19
174 0.22
175 0.24
176 0.24
177 0.21
178 0.16
179 0.14
180 0.15
181 0.15
182 0.12
183 0.12
184 0.1
185 0.1
186 0.08
187 0.08
188 0.06
189 0.07
190 0.08
191 0.08
192 0.07
193 0.08
194 0.07
195 0.07
196 0.07
197 0.06
198 0.05
199 0.04
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.07
206 0.07
207 0.07
208 0.07
209 0.09
210 0.12
211 0.17
212 0.19
213 0.19
214 0.22
215 0.27
216 0.28
217 0.29
218 0.34
219 0.36
220 0.4
221 0.5
222 0.47
223 0.44
224 0.45
225 0.44
226 0.36
227 0.34
228 0.29
229 0.22
230 0.24
231 0.26
232 0.24
233 0.24
234 0.24
235 0.2
236 0.18
237 0.17
238 0.13
239 0.1
240 0.09
241 0.09
242 0.08
243 0.08
244 0.08
245 0.06
246 0.07
247 0.07
248 0.13
249 0.12
250 0.14
251 0.14
252 0.14
253 0.14
254 0.14
255 0.14
256 0.09
257 0.1
258 0.08
259 0.08
260 0.09
261 0.08
262 0.08
263 0.07
264 0.09
265 0.09
266 0.1
267 0.1
268 0.1
269 0.11
270 0.16
271 0.2
272 0.21
273 0.19
274 0.27
275 0.29
276 0.32
277 0.37
278 0.36
279 0.34
280 0.38
281 0.44
282 0.44
283 0.5
284 0.56
285 0.54
286 0.57
287 0.6
288 0.62
289 0.62
290 0.61
291 0.57
292 0.55
293 0.55
294 0.55
295 0.49
296 0.42
297 0.38
298 0.34
299 0.29
300 0.23
301 0.22
302 0.18
303 0.19
304 0.2
305 0.2
306 0.18
307 0.19
308 0.2
309 0.18
310 0.19
311 0.22
312 0.23
313 0.21
314 0.21
315 0.18
316 0.19
317 0.19
318 0.16
319 0.12
320 0.11
321 0.18
322 0.18
323 0.18
324 0.17
325 0.18
326 0.2
327 0.21
328 0.19
329 0.17
330 0.21
331 0.21
332 0.21
333 0.2
334 0.18
335 0.17
336 0.18
337 0.17
338 0.14
339 0.15
340 0.16
341 0.21
342 0.2
343 0.2
344 0.21
345 0.2
346 0.21
347 0.23
348 0.22
349 0.19
350 0.22
351 0.25
352 0.26
353 0.26
354 0.24
355 0.28
356 0.28
357 0.32
358 0.33
359 0.36
360 0.37
361 0.38
362 0.38
363 0.38
364 0.37
365 0.36
366 0.35
367 0.32
368 0.3
369 0.28
370 0.29
371 0.25
372 0.25
373 0.21
374 0.18
375 0.15
376 0.14
377 0.15
378 0.11
379 0.11
380 0.1
381 0.13
382 0.13
383 0.16
384 0.15
385 0.15
386 0.16
387 0.17
388 0.17
389 0.15
390 0.15
391 0.19
392 0.17
393 0.17
394 0.18
395 0.17
396 0.19
397 0.21
398 0.26
399 0.27
400 0.3
401 0.32
402 0.36
403 0.44
404 0.49
405 0.57
406 0.59
407 0.62
408 0.67
409 0.7
410 0.71
411 0.72
412 0.7
413 0.68
414 0.7
415 0.66
416 0.64
417 0.58
418 0.58
419 0.57
420 0.55
421 0.5
422 0.41
423 0.36
424 0.36
425 0.37
426 0.33
427 0.28
428 0.3
429 0.36
430 0.42
431 0.47
432 0.47
433 0.5
434 0.49
435 0.49
436 0.47
437 0.47
438 0.49
439 0.46
440 0.44
441 0.41
442 0.42
443 0.39
444 0.35
445 0.29
446 0.22
447 0.2
448 0.18
449 0.17
450 0.24
451 0.28
452 0.32
453 0.32
454 0.32
455 0.33
456 0.39
457 0.45
458 0.46
459 0.47
460 0.48
461 0.56
462 0.63
463 0.68
464 0.67
465 0.65
466 0.59
467 0.6
468 0.63
469 0.61
470 0.55
471 0.51
472 0.52
473 0.51
474 0.55
475 0.5
476 0.4
477 0.35
478 0.34
479 0.31
480 0.27
481 0.25
482 0.17
483 0.18
484 0.18
485 0.18
486 0.17
487 0.21
488 0.19
489 0.18
490 0.18
491 0.21
492 0.21
493 0.21
494 0.18
495 0.19
496 0.22