Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q758J0

Protein Details
Accession Q758J0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
147-173KSSIAKSSGRERAKKRKKNMLSNLLAAHydrophilic
NLS Segment(s)
PositionSequence
146-165SKSSIAKSSGRERAKKRKKN
Subcellular Location(s) nucl 15.5, mito_nucl 12.5, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0042134  F:rRNA primary transcript binding  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0006397  P:mRNA processing  
GO:0030541  P:plasmid partitioning  
GO:0008033  P:tRNA processing  
KEGG ago:AGOS_AEL228W  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MRLMEMSTAVTTNNGMNRLEKDNFMRIHLQHKYTLLHHLSSADVTHLSGLYLKSFYNAVKRNRVVLPNIICDGDVKFCGSCGIVYVAGVNLQAHVQETSQEDGIVKKELVYKCLKCSHEKRFVLSQSDPPVPKAPFVAKWPSKENSKSSIAKSSGRERAKKRKKNMLSNLLAAKKQHESTKGKVSLQLEDFMKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.19
4 0.22
5 0.28
6 0.29
7 0.3
8 0.31
9 0.36
10 0.36
11 0.37
12 0.39
13 0.34
14 0.41
15 0.44
16 0.42
17 0.37
18 0.39
19 0.38
20 0.34
21 0.41
22 0.34
23 0.29
24 0.27
25 0.25
26 0.23
27 0.21
28 0.19
29 0.12
30 0.1
31 0.09
32 0.09
33 0.08
34 0.07
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.09
41 0.11
42 0.12
43 0.18
44 0.25
45 0.3
46 0.38
47 0.39
48 0.42
49 0.45
50 0.47
51 0.41
52 0.41
53 0.39
54 0.33
55 0.33
56 0.28
57 0.24
58 0.21
59 0.2
60 0.14
61 0.11
62 0.09
63 0.08
64 0.08
65 0.08
66 0.08
67 0.06
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.04
83 0.06
84 0.07
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.08
93 0.08
94 0.14
95 0.15
96 0.18
97 0.24
98 0.24
99 0.28
100 0.35
101 0.36
102 0.38
103 0.45
104 0.5
105 0.55
106 0.54
107 0.54
108 0.54
109 0.55
110 0.52
111 0.47
112 0.43
113 0.37
114 0.42
115 0.38
116 0.33
117 0.36
118 0.31
119 0.29
120 0.27
121 0.25
122 0.22
123 0.26
124 0.34
125 0.32
126 0.36
127 0.41
128 0.42
129 0.46
130 0.48
131 0.48
132 0.44
133 0.47
134 0.48
135 0.45
136 0.49
137 0.45
138 0.45
139 0.46
140 0.49
141 0.51
142 0.54
143 0.6
144 0.61
145 0.69
146 0.75
147 0.8
148 0.81
149 0.83
150 0.86
151 0.88
152 0.9
153 0.89
154 0.83
155 0.79
156 0.78
157 0.71
158 0.63
159 0.52
160 0.46
161 0.41
162 0.39
163 0.39
164 0.4
165 0.41
166 0.46
167 0.55
168 0.57
169 0.53
170 0.55
171 0.52
172 0.51
173 0.47
174 0.47