Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KXW7

Protein Details
Accession A0A5C3KXW7    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-33WAKLLKKRSKESKQGGTGKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 9, extr 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MGPRTLCNACGLVWAKLLKKRSKESKQGGTGKTAQGRSSNANAGNANASNSNNAGGGSNGMNVSMGSPRADSNDGESDFGDVSRDGRMDDGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.32
4 0.39
5 0.39
6 0.44
7 0.52
8 0.59
9 0.65
10 0.72
11 0.75
12 0.77
13 0.8
14 0.81
15 0.73
16 0.67
17 0.61
18 0.54
19 0.51
20 0.43
21 0.34
22 0.29
23 0.29
24 0.28
25 0.27
26 0.26
27 0.21
28 0.22
29 0.21
30 0.19
31 0.18
32 0.15
33 0.13
34 0.1
35 0.1
36 0.08
37 0.08
38 0.08
39 0.07
40 0.07
41 0.07
42 0.06
43 0.07
44 0.06
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.08
55 0.08
56 0.11
57 0.13
58 0.13
59 0.17
60 0.22
61 0.22
62 0.23
63 0.22
64 0.21
65 0.19
66 0.19
67 0.15
68 0.09
69 0.09
70 0.11
71 0.11
72 0.1