Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3L810

Protein Details
Accession A0A5C3L810    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
3-22PRRARDPRFARPDPRLQRQGBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006811  RNA_pol_II_suA  
Gene Ontology GO:0005634  C:nucleus  
GO:0017018  F:myosin phosphatase activity  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF04722  Ssu72  
Amino Acid Sequences MDPRRARDPRFARPDPRLQRQGQSPIPQPQSHGPPQQQSYNNAMPSQSMDLASSSAGPSNSGLRTDESKPSVNEETNPMNGYKARPLFCVVCASNQNRSMEGHNVLSKAGYRVISSGTGSAVRLPGPSIDKPNIYSFGTPYNTIYEELSSKDPRLYTANGLLPMLDRNRRIKLAPERWQETRTTADVVITCEERCFDAVCDDLMNRGGELNKPVHVVNMEIKDNHEEALIAGKAMLDLAAAIEATDDIDENIDKILEVQQEKHPHNLLHAVAYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.8
4 0.78
5 0.72
6 0.72
7 0.71
8 0.73
9 0.69
10 0.67
11 0.64
12 0.64
13 0.66
14 0.6
15 0.56
16 0.54
17 0.54
18 0.55
19 0.56
20 0.51
21 0.53
22 0.56
23 0.6
24 0.57
25 0.54
26 0.54
27 0.52
28 0.49
29 0.42
30 0.38
31 0.3
32 0.29
33 0.27
34 0.2
35 0.15
36 0.14
37 0.13
38 0.14
39 0.13
40 0.11
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.13
47 0.13
48 0.14
49 0.15
50 0.15
51 0.2
52 0.22
53 0.27
54 0.27
55 0.29
56 0.29
57 0.33
58 0.34
59 0.31
60 0.3
61 0.29
62 0.28
63 0.27
64 0.27
65 0.22
66 0.2
67 0.2
68 0.2
69 0.22
70 0.24
71 0.24
72 0.24
73 0.27
74 0.27
75 0.26
76 0.3
77 0.24
78 0.23
79 0.28
80 0.29
81 0.32
82 0.34
83 0.34
84 0.29
85 0.3
86 0.28
87 0.26
88 0.25
89 0.22
90 0.2
91 0.19
92 0.18
93 0.17
94 0.15
95 0.13
96 0.13
97 0.1
98 0.09
99 0.09
100 0.1
101 0.11
102 0.1
103 0.1
104 0.08
105 0.08
106 0.08
107 0.08
108 0.07
109 0.07
110 0.07
111 0.07
112 0.08
113 0.11
114 0.12
115 0.15
116 0.16
117 0.17
118 0.18
119 0.2
120 0.2
121 0.18
122 0.17
123 0.14
124 0.17
125 0.17
126 0.16
127 0.15
128 0.14
129 0.14
130 0.14
131 0.14
132 0.1
133 0.1
134 0.11
135 0.14
136 0.13
137 0.13
138 0.14
139 0.14
140 0.14
141 0.17
142 0.17
143 0.15
144 0.18
145 0.2
146 0.19
147 0.19
148 0.17
149 0.14
150 0.15
151 0.16
152 0.15
153 0.17
154 0.2
155 0.23
156 0.25
157 0.25
158 0.31
159 0.39
160 0.45
161 0.51
162 0.55
163 0.57
164 0.58
165 0.59
166 0.51
167 0.43
168 0.37
169 0.29
170 0.24
171 0.2
172 0.19
173 0.18
174 0.18
175 0.17
176 0.15
177 0.13
178 0.12
179 0.12
180 0.11
181 0.11
182 0.1
183 0.09
184 0.1
185 0.1
186 0.1
187 0.11
188 0.1
189 0.11
190 0.11
191 0.11
192 0.09
193 0.1
194 0.11
195 0.11
196 0.15
197 0.16
198 0.15
199 0.16
200 0.16
201 0.17
202 0.16
203 0.17
204 0.19
205 0.22
206 0.23
207 0.22
208 0.24
209 0.25
210 0.25
211 0.23
212 0.17
213 0.13
214 0.11
215 0.16
216 0.14
217 0.11
218 0.1
219 0.1
220 0.09
221 0.09
222 0.09
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.06
236 0.06
237 0.06
238 0.07
239 0.07
240 0.06
241 0.07
242 0.12
243 0.16
244 0.18
245 0.21
246 0.29
247 0.38
248 0.4
249 0.45
250 0.46
251 0.41
252 0.42
253 0.45
254 0.38