Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KNK2

Protein Details
Accession A0A5C3KNK2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-43LFCPPRNHFRRKPTKATRSLIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 6, extr 4
Family & Domain DBs
Amino Acid Sequences MSTVCCIAFCVSLMLAVVTSQPLFCPPRNHFRRKPTKATRSLIEARCLRKSLFRAQSMGIIAGSPPKDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.05
9 0.09
10 0.13
11 0.15
12 0.22
13 0.25
14 0.36
15 0.44
16 0.53
17 0.56
18 0.64
19 0.72
20 0.72
21 0.79
22 0.79
23 0.8
24 0.8
25 0.76
26 0.68
27 0.63
28 0.65
29 0.56
30 0.53
31 0.48
32 0.44
33 0.43
34 0.43
35 0.37
36 0.35
37 0.37
38 0.4
39 0.43
40 0.42
41 0.41
42 0.41
43 0.44
44 0.39
45 0.35
46 0.25
47 0.17
48 0.14
49 0.17