Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3L407

Protein Details
Accession A0A5C3L407    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20EPQFRSKAWRREPEPQFRSKHydrophilic
93-114APEPQFRSKAWRREPEPQFRSKHydrophilic
NLS Segment(s)
PositionSequence
10-119RREPEPQFRSKAWRREPEPEPQFRSKAWRREPEPAPEPQFRSKAWRREPEPAPEPQFRSKAWRREPEPEPQFRSKAWRREPEPAPEPQFRSKAWRREPEPQFRSKAWRRE
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences EPQFRSKAWRREPEPQFRSKAWRREPEPEPQFRSKAWRREPEPAPEPQFRSKAWRREPEPAPEPQFRSKAWRREPEPEPQFRSKAWRREPEPAPEPQFRSKAWRREPEPQFRSKAWRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.73
4 0.65
5 0.69
6 0.67
7 0.68
8 0.67
9 0.71
10 0.69
11 0.72
12 0.72
13 0.73
14 0.72
15 0.7
16 0.67
17 0.62
18 0.58
19 0.51
20 0.58
21 0.56
22 0.58
23 0.6
24 0.63
25 0.62
26 0.69
27 0.72
28 0.7
29 0.65
30 0.61
31 0.57
32 0.5
33 0.5
34 0.46
35 0.44
36 0.36
37 0.42
38 0.44
39 0.49
40 0.55
41 0.61
42 0.61
43 0.67
44 0.71
45 0.7
46 0.65
47 0.61
48 0.57
49 0.5
50 0.5
51 0.46
52 0.44
53 0.36
54 0.42
55 0.44
56 0.49
57 0.55
58 0.61
59 0.62
60 0.68
61 0.71
62 0.73
63 0.72
64 0.7
65 0.67
66 0.62
67 0.58
68 0.51
69 0.58
70 0.56
71 0.58
72 0.6
73 0.63
74 0.62
75 0.69
76 0.72
77 0.7
78 0.65
79 0.61
80 0.57
81 0.5
82 0.5
83 0.46
84 0.44
85 0.36
86 0.42
87 0.44
88 0.49
89 0.55
90 0.61
91 0.63
92 0.71
93 0.8
94 0.82
95 0.8
96 0.77
97 0.73
98 0.65
99 0.69