Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FTQ3

Protein Details
Accession C5FTQ3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
5-24PVTLRTRKFIRNPLLNRKQMHydrophilic
97-129VVDKIERPSRKQRKSSKIRAKKLRGTAKVKGVKBasic
NLS Segment(s)
PositionSequence
102-133ERPSRKQRKSSKIRAKKLRGTAKVKGVKKAKK
Subcellular Location(s) mito 14, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADTPVTLRTRKFIRNPLLNRKQMVVDILHPNRANIKKDDLRTKLGELYKASKEQISVFGLRTHYGGGKTTGFALIYDSTEALKKFEPRYRLVRYGVVDKIERPSRKQRKSSKIRAKKLRGTAKVKGVKKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.73
4 0.78
5 0.82
6 0.78
7 0.72
8 0.65
9 0.56
10 0.47
11 0.41
12 0.31
13 0.26
14 0.31
15 0.31
16 0.34
17 0.33
18 0.32
19 0.38
20 0.41
21 0.39
22 0.32
23 0.39
24 0.4
25 0.46
26 0.54
27 0.5
28 0.5
29 0.48
30 0.47
31 0.45
32 0.4
33 0.37
34 0.31
35 0.32
36 0.29
37 0.29
38 0.28
39 0.22
40 0.21
41 0.19
42 0.2
43 0.18
44 0.16
45 0.15
46 0.17
47 0.17
48 0.16
49 0.15
50 0.13
51 0.11
52 0.11
53 0.11
54 0.1
55 0.1
56 0.09
57 0.1
58 0.09
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.1
71 0.14
72 0.19
73 0.24
74 0.28
75 0.31
76 0.38
77 0.44
78 0.47
79 0.45
80 0.44
81 0.42
82 0.44
83 0.41
84 0.36
85 0.31
86 0.27
87 0.32
88 0.35
89 0.35
90 0.36
91 0.45
92 0.53
93 0.62
94 0.7
95 0.74
96 0.77
97 0.85
98 0.9
99 0.91
100 0.91
101 0.92
102 0.93
103 0.92
104 0.9
105 0.9
106 0.89
107 0.87
108 0.84
109 0.81
110 0.8
111 0.8
112 0.75
113 0.74