Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3KKN8

Protein Details
Accession A0A5C3KKN8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
164-184FIYAEIKRQHYRERRQKRRDRBasic
NLS Segment(s)
PositionSequence
175-184RERRQKRRDR
Subcellular Location(s) nucl 15, cyto 7, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MRLILDGPSPLYSTYFTEDGAPIYEIELHAGAGFLDRKTRIHKMHVESGNFLPFAEFELHSFNQDRLRMGTIFDVSADEMFRCEPGIYFSGDDRIFLGPDNREYRWIATSRKVDLVVNDDTGTLVAKFHHKHHEIFSFIQEPCPASFEIFPPGEHMIDLIMLTFIYAEIKRQHYRERRQKRRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.18
5 0.18
6 0.18
7 0.18
8 0.16
9 0.11
10 0.11
11 0.12
12 0.1
13 0.11
14 0.1
15 0.08
16 0.07
17 0.07
18 0.06
19 0.08
20 0.09
21 0.08
22 0.12
23 0.13
24 0.15
25 0.21
26 0.3
27 0.31
28 0.37
29 0.45
30 0.47
31 0.56
32 0.59
33 0.55
34 0.51
35 0.49
36 0.43
37 0.35
38 0.29
39 0.19
40 0.13
41 0.14
42 0.13
43 0.11
44 0.09
45 0.15
46 0.15
47 0.17
48 0.18
49 0.17
50 0.19
51 0.2
52 0.2
53 0.17
54 0.19
55 0.18
56 0.17
57 0.17
58 0.14
59 0.12
60 0.11
61 0.1
62 0.08
63 0.08
64 0.07
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.08
74 0.08
75 0.09
76 0.09
77 0.13
78 0.13
79 0.13
80 0.11
81 0.11
82 0.1
83 0.1
84 0.12
85 0.08
86 0.13
87 0.16
88 0.15
89 0.17
90 0.18
91 0.19
92 0.21
93 0.23
94 0.21
95 0.25
96 0.28
97 0.28
98 0.29
99 0.28
100 0.25
101 0.23
102 0.25
103 0.19
104 0.17
105 0.15
106 0.13
107 0.12
108 0.12
109 0.11
110 0.07
111 0.06
112 0.06
113 0.11
114 0.13
115 0.17
116 0.26
117 0.29
118 0.31
119 0.36
120 0.4
121 0.38
122 0.38
123 0.38
124 0.34
125 0.31
126 0.31
127 0.26
128 0.23
129 0.2
130 0.21
131 0.17
132 0.14
133 0.15
134 0.14
135 0.19
136 0.18
137 0.18
138 0.19
139 0.2
140 0.19
141 0.17
142 0.16
143 0.1
144 0.1
145 0.1
146 0.06
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.07
153 0.07
154 0.11
155 0.16
156 0.23
157 0.29
158 0.33
159 0.44
160 0.51
161 0.63
162 0.7
163 0.76
164 0.81