Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3L6G0

Protein Details
Accession A0A5C3L6G0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
135-158DENSRRIKFIKKKYKQPADNSVREHydrophilic
NLS Segment(s)
PositionSequence
139-147RRIKFIKKK
Subcellular Location(s) nucl 15, cyto_nucl 14.5, cyto 10
Family & Domain DBs
Amino Acid Sequences MRSNACSSGKEVQPLETEVRETFSVELETLWREEKQYLMGNGNEEEASRRYAQNEEKLPQEAYATQLIPVAGKGLVAEAQSQSTGGEDEQNPSNVDGSTATKQGNNDLQEDTKLITDIEASVLQGLQKQKERLRDENSRRIKFIKKKYKQPADNSVREEKLNVVGRRSKIEEEIFKRFEQVLCKVPSEQDQEDRTEKVQNGQDEKRDEISGGRVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.29
4 0.28
5 0.23
6 0.25
7 0.22
8 0.2
9 0.17
10 0.15
11 0.15
12 0.13
13 0.13
14 0.11
15 0.12
16 0.12
17 0.14
18 0.13
19 0.14
20 0.14
21 0.15
22 0.18
23 0.22
24 0.23
25 0.24
26 0.25
27 0.25
28 0.25
29 0.25
30 0.21
31 0.16
32 0.16
33 0.14
34 0.16
35 0.16
36 0.16
37 0.17
38 0.23
39 0.28
40 0.33
41 0.37
42 0.36
43 0.36
44 0.38
45 0.37
46 0.31
47 0.27
48 0.2
49 0.17
50 0.17
51 0.15
52 0.12
53 0.13
54 0.13
55 0.11
56 0.1
57 0.09
58 0.06
59 0.06
60 0.05
61 0.05
62 0.06
63 0.06
64 0.07
65 0.06
66 0.07
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.05
73 0.08
74 0.08
75 0.11
76 0.12
77 0.13
78 0.13
79 0.13
80 0.14
81 0.1
82 0.1
83 0.09
84 0.1
85 0.11
86 0.12
87 0.12
88 0.13
89 0.13
90 0.16
91 0.19
92 0.17
93 0.17
94 0.16
95 0.16
96 0.15
97 0.16
98 0.14
99 0.09
100 0.08
101 0.07
102 0.05
103 0.05
104 0.05
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.08
112 0.1
113 0.12
114 0.16
115 0.21
116 0.25
117 0.33
118 0.39
119 0.43
120 0.49
121 0.56
122 0.6
123 0.65
124 0.72
125 0.65
126 0.61
127 0.59
128 0.61
129 0.6
130 0.63
131 0.64
132 0.63
133 0.71
134 0.8
135 0.86
136 0.85
137 0.83
138 0.83
139 0.81
140 0.79
141 0.74
142 0.69
143 0.6
144 0.52
145 0.45
146 0.36
147 0.34
148 0.36
149 0.32
150 0.31
151 0.36
152 0.37
153 0.41
154 0.43
155 0.37
156 0.34
157 0.38
158 0.42
159 0.42
160 0.49
161 0.47
162 0.43
163 0.44
164 0.41
165 0.38
166 0.34
167 0.33
168 0.32
169 0.33
170 0.35
171 0.33
172 0.34
173 0.38
174 0.39
175 0.38
176 0.38
177 0.37
178 0.4
179 0.42
180 0.42
181 0.37
182 0.37
183 0.34
184 0.34
185 0.38
186 0.4
187 0.44
188 0.48
189 0.53
190 0.51
191 0.53
192 0.49
193 0.44
194 0.38
195 0.32