Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3KCY0

Protein Details
Accession A0A5C3KCY0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-30GASNLGNRKVNRRQTKRKCKAMATDRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MDAGASNLGNRKVNRRQTKRKCKAMATDRSDPEQEEGSSVETELVALPTGTIDVEEGGALDLPNRASLDPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.74
4 0.8
5 0.9
6 0.91
7 0.92
8 0.88
9 0.83
10 0.82
11 0.81
12 0.8
13 0.75
14 0.73
15 0.65
16 0.61
17 0.55
18 0.45
19 0.37
20 0.28
21 0.21
22 0.14
23 0.12
24 0.11
25 0.1
26 0.09
27 0.08
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.03
35 0.03
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.06
49 0.07
50 0.09
51 0.1
52 0.09