Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3L6J9

Protein Details
Accession A0A5C3L6J9    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-55LCTHNKPSSSPRVHPKRKNAFEPAQRRNYSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, mito_nucl 12.333, cyto_mito 11.833, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003782  SCO1/SenC  
IPR017276  Synth_of_cyt-c-oxidase_Sco1/2  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0016531  F:copper chaperone activity  
GO:0005507  F:copper ion binding  
GO:0006878  P:intracellular copper ion homeostasis  
GO:0008535  P:respiratory chain complex IV assembly  
Pfam View protein in Pfam  
PF02630  SCO1-SenC  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd02968  SCO  
Amino Acid Sequences MLSFLFSRRAPALCVRRAQIPSIRTLCTHNKPSSSPRVHPKRKNAFEPAQRRNYSDHNEKERNAIGVFGPRAAFAFLATGVALWFYFRNEKLRLKEEKEKERASKQYGRPNLGGQFTLTSHEGKPFTEEELEGKWSLVYFGFTNCPDICPAELDKISTVLDTVQKEHGDIFLPLFITVDPARDLPHRIARYLEDFHPSFIGLFGDYDATKAICKKYRVYFSTPANADPKGDYLVDHSIFVYLMDPQGKFVDAFGQSVPQEDVVEKINKEVNDWQRQTGKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.5
4 0.51
5 0.53
6 0.5
7 0.43
8 0.46
9 0.44
10 0.43
11 0.37
12 0.41
13 0.45
14 0.47
15 0.53
16 0.49
17 0.5
18 0.53
19 0.59
20 0.64
21 0.62
22 0.61
23 0.63
24 0.7
25 0.76
26 0.81
27 0.84
28 0.84
29 0.85
30 0.85
31 0.84
32 0.82
33 0.81
34 0.83
35 0.81
36 0.8
37 0.73
38 0.68
39 0.63
40 0.61
41 0.59
42 0.58
43 0.57
44 0.57
45 0.61
46 0.59
47 0.6
48 0.55
49 0.49
50 0.39
51 0.31
52 0.23
53 0.23
54 0.23
55 0.19
56 0.17
57 0.15
58 0.15
59 0.14
60 0.13
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.05
67 0.04
68 0.05
69 0.04
70 0.04
71 0.05
72 0.06
73 0.1
74 0.11
75 0.17
76 0.21
77 0.28
78 0.32
79 0.39
80 0.45
81 0.48
82 0.56
83 0.6
84 0.64
85 0.66
86 0.66
87 0.64
88 0.64
89 0.64
90 0.61
91 0.62
92 0.59
93 0.61
94 0.61
95 0.6
96 0.54
97 0.51
98 0.47
99 0.39
100 0.33
101 0.24
102 0.19
103 0.15
104 0.16
105 0.14
106 0.12
107 0.11
108 0.15
109 0.15
110 0.13
111 0.16
112 0.14
113 0.14
114 0.13
115 0.13
116 0.11
117 0.12
118 0.13
119 0.11
120 0.1
121 0.09
122 0.08
123 0.08
124 0.07
125 0.07
126 0.05
127 0.06
128 0.08
129 0.08
130 0.11
131 0.11
132 0.11
133 0.11
134 0.11
135 0.1
136 0.1
137 0.11
138 0.11
139 0.11
140 0.11
141 0.11
142 0.11
143 0.11
144 0.09
145 0.08
146 0.06
147 0.1
148 0.1
149 0.12
150 0.14
151 0.13
152 0.14
153 0.14
154 0.13
155 0.11
156 0.1
157 0.09
158 0.07
159 0.08
160 0.07
161 0.08
162 0.07
163 0.08
164 0.08
165 0.09
166 0.09
167 0.09
168 0.11
169 0.12
170 0.14
171 0.15
172 0.23
173 0.23
174 0.23
175 0.25
176 0.25
177 0.29
178 0.3
179 0.27
180 0.25
181 0.24
182 0.24
183 0.23
184 0.21
185 0.16
186 0.13
187 0.12
188 0.07
189 0.07
190 0.06
191 0.07
192 0.07
193 0.07
194 0.07
195 0.07
196 0.08
197 0.11
198 0.17
199 0.21
200 0.24
201 0.31
202 0.38
203 0.47
204 0.51
205 0.55
206 0.57
207 0.56
208 0.62
209 0.57
210 0.52
211 0.46
212 0.42
213 0.36
214 0.29
215 0.25
216 0.19
217 0.18
218 0.14
219 0.15
220 0.2
221 0.2
222 0.19
223 0.18
224 0.16
225 0.16
226 0.16
227 0.12
228 0.07
229 0.1
230 0.12
231 0.12
232 0.13
233 0.14
234 0.15
235 0.15
236 0.14
237 0.18
238 0.15
239 0.17
240 0.16
241 0.19
242 0.18
243 0.2
244 0.2
245 0.15
246 0.15
247 0.14
248 0.15
249 0.16
250 0.21
251 0.19
252 0.22
253 0.26
254 0.25
255 0.28
256 0.36
257 0.4
258 0.47
259 0.49
260 0.52
261 0.56