Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3L4D5

Protein Details
Accession A0A5C3L4D5   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
154-187RTNPHEIKTQPKPPRRNHKNHKTPNPKTDTKKKHBasic
NLS Segment(s)
PositionSequence
79-89PKRDLRPSRKG
162-187TQPKPPRRNHKNHKTPNPKTDTKKKH
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MHGKRIRNRQNPCIPATNRNHISNIASPNIVSPNIVPQTVSPYLQPTVSPTNQPNANPTTPTRSTHARAHPKSIIHPQPKRDLRPSRKGTTRNGVAETRKKGITQNQNPKPGSPQNQNHESKTTNPKPPQIQNHHKSKTTTNPKPPQIHESNPRTNPHEIKTQPKPPRRNHKNHKTPNPKTDTKKKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.7
3 0.69
4 0.69
5 0.64
6 0.61
7 0.57
8 0.49
9 0.49
10 0.45
11 0.42
12 0.33
13 0.28
14 0.25
15 0.25
16 0.26
17 0.21
18 0.16
19 0.12
20 0.17
21 0.19
22 0.19
23 0.17
24 0.15
25 0.22
26 0.23
27 0.23
28 0.16
29 0.18
30 0.19
31 0.19
32 0.19
33 0.16
34 0.22
35 0.22
36 0.26
37 0.25
38 0.29
39 0.32
40 0.32
41 0.32
42 0.31
43 0.31
44 0.29
45 0.29
46 0.31
47 0.3
48 0.32
49 0.31
50 0.31
51 0.34
52 0.4
53 0.47
54 0.5
55 0.5
56 0.54
57 0.54
58 0.5
59 0.5
60 0.51
61 0.51
62 0.49
63 0.52
64 0.5
65 0.56
66 0.61
67 0.61
68 0.61
69 0.63
70 0.61
71 0.68
72 0.7
73 0.67
74 0.69
75 0.68
76 0.64
77 0.61
78 0.58
79 0.5
80 0.46
81 0.42
82 0.4
83 0.42
84 0.4
85 0.35
86 0.3
87 0.28
88 0.29
89 0.34
90 0.4
91 0.44
92 0.52
93 0.56
94 0.64
95 0.63
96 0.61
97 0.58
98 0.54
99 0.51
100 0.49
101 0.5
102 0.48
103 0.57
104 0.6
105 0.55
106 0.52
107 0.47
108 0.44
109 0.47
110 0.48
111 0.47
112 0.48
113 0.53
114 0.56
115 0.63
116 0.66
117 0.66
118 0.7
119 0.69
120 0.76
121 0.74
122 0.71
123 0.66
124 0.62
125 0.62
126 0.63
127 0.64
128 0.64
129 0.69
130 0.73
131 0.78
132 0.75
133 0.73
134 0.69
135 0.67
136 0.67
137 0.66
138 0.67
139 0.65
140 0.66
141 0.61
142 0.62
143 0.58
144 0.52
145 0.53
146 0.48
147 0.51
148 0.57
149 0.62
150 0.66
151 0.71
152 0.77
153 0.78
154 0.85
155 0.87
156 0.89
157 0.91
158 0.92
159 0.93
160 0.95
161 0.96
162 0.95
163 0.94
164 0.93
165 0.91
166 0.89
167 0.87